阅读说明：本技术 一种tcr及其应用 (TCR and application thereof ) 是由 吴显辉 于 2019-08-30 设计创作，主要内容包括：本发明公开了一种TCR及其应用。所述的TCR包含TCRα链可变区和/或TCRβ链可变区,所述的TCR能够特异性识别并结合HLA-A*02:01/SLLMWITQC,其特征在于,所述TCR与所述的HLA-A*02:01/SLLMWITQC的亲和力K_(D1)为0.1～10μM；所述的TCR还能够特异性识别并结合HLA-A*02:03/SLLMWITQC、HLA-A*02:09/SLLMWITQC、HLA-A*02:12/SLLMWITQC以及HLA-A*02:16/SLLMWITQC中的一种或多种,且亲和力为K_(D2)为0.1～85μM。本发明的TCR具有极高的亲和力和很好的安全性,具有更广的适用性。(The invention discloses a TCR and application thereof. The TCR comprises a TCR alpha chain variable region and/or a TCR beta chain variable region, and the TCR can specifically recognize and bind to HLA-A02: 01/SLLMWITQC, wherein the affinity K of said TCR to said HLA-A02: 01/SLLMWITQC D1 0.1 to 10 μ M; the TCR can also specifically recognize and bind one or more of HLA-A02: 03/SLLMWITQC, HLA-A02: 09/SLLMWITQC, HLA-A02: 12/SLLMWITQC and HLA-A02: 16/SLLMWITQC, and has the affinity of K D2 0.1 to 85 μ M. The TCR of the invention has extremely high affinity, good safety and wider applicability.)

1. A TCR comprising a TCR alpha chain variable region and/or a TCR beta chain variable region, the TCR being capable of specifically recognising and binding HLA-A02: 01/SLLMWITQC, the TCR having an affinity K for said HLA-A02: 01/SLLMWITQC_D10.1-10 μ M, preferably 0.39-9.3 μ M, more preferably 0.81-3.2 μ M, wherein the TCR is capable of specifically recognizing and binding HLA-A02: 03/SLLMWITQC, HLA-A02: 09/SLLMWITQC, HLA-A02: 12/SLLMWITQC and HLA-A02:16/SLLMWITQC, and affinity K_D20.1 to 85 μ M, preferably 0.57 to 27 μ M, more preferably 1.3 to 10 μ M;

wherein: affinity K of said TCR to said HLA-A02: 16/SLLMWITQC_DPreferably 0.16 to 23 μ M, and more preferably 1.3 to 12 μ M;

affinity K of said TCR to said HLA-A02: 03/SLLMWITQC_DPreferably 1.1 to 76 μ M, more preferably 2.3 to 9 μ M;

affinity K of said TCR to said HLA-A02: 09/SLLMWITQC_DPreferably 0.1 to 8.3. mu.M, more preferably 0.51 to 5.6. mu.M, further preferably 0.57 to 3. mu.M;

affinity K of said TCR to said HLA-A02: 12/SLLMWITQC_DPreferably 0.88 to 85 μ M, more preferably 3 to 35 μ M, and further preferably 5.1 to 10 μ M.

2. A TCR as claimed in claim 1 which is capable of specifically recognising and binding to HLA-a02: 09/SLLMWITQC and/or HLA-a02: 12/SLLMWITQC;

alternatively, the TCR may be capable of specifically recognising and binding HLA-A02: 03/SLLMWITQC and/or HLA-A02: 16/SLLMWITQC.

3. A TCR as claimed in claim 2 in which the amino acid sequences of CDR1, CDR2 and CDR3 of the α chain variable region of the TCR are as set out in SEQ ID No.71, SEQ ID No.72 and SEQ ID No.1, respectively, or are derived from SEQ ID No.71, SEQ ID No.72 and SEQ ID No.1, respectively; preferably:

the identity of the derived sequence of SEQ ID NO.71 and the sequence shown in SEQ ID NO.71 is 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or more than 99%,

the identity of the derived sequence of SEQ ID NO.72 and the sequence shown in SEQ ID NO.72 is 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or more than 99%,

the identity of the derived sequence of SEQ ID NO.1 and the sequence shown in SEQ ID NO.1 is more than 55%, preferably more than 66.67%, more preferably more than 77.78%, and further more preferably more than 88.89%;

the derivative sequence of SEQ ID NO.1 is preferably obtained by performing 1,2, 3 or 4 point mutations on the sequence shown in SEQ ID NO. 1;

more preferably, the derivative sequence of SEQ ID NO.1 is an amino acid sequence which is subjected to amino acid substitution at least at position 2 of the sequence shown in SEQ ID NO.1, and the substituted amino acid is an aromatic amino acid; preferably tyrosine or phenylalanine; the substitution of the amino acid sequence shown in SEQ ID No.1 preferably also takes place at positions 1,4 and/or 5;

even more preferably, when the amino acid after the 2 nd position substitution is tyrosine, the substitution performed on the amino acid sequence shown in SEQ ID NO.1 also occurs at the 1 st, 4 th and/or 5 th positions; when the amino acid substituted at the 2 nd position is phenylalanine, the substitution for the amino acid sequence shown in SEQ ID No.1 also occurs at the 5 th position; the substituted amino acid is preferably valine for the 1 st position; the substituted amino acid is preferably glutamic acid, valine or alanine with respect to the 4 th position; preferably, the substituted amino acid is histidine, asparagine, tryptophan or alanine for position 5;

most preferably, the derived sequence of SEQ ID NO.1 is shown as any one of SEQ ID NO. 3-13 in the sequence table.

4. A TCR as claimed in any one of claims 1 to 3 wherein the amino acid sequences of CDR1, CDR2 and CDR3 of the β chain variable region of the TCR are shown in SEQ ID No.73, SEQ ID No.74 and SEQ ID No.2 respectively, or derived sequences of SEQ ID No.73, SEQ ID No.74 and SEQ ID No.2 respectively; preferably:

the identity of the derived sequence of SEQ ID NO.73 and the sequence shown in SEQ ID NO.73 is 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or more than 99%,

the identity of the derived sequence of SEQ ID NO.74 and the sequence shown in SEQ ID NO.74 is 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or more than 99%,

the identity of the derived sequence of SEQ ID NO.2 and the sequence shown in SEQ ID NO.2 is more than 70%, preferably more than 80%, and more preferably more than 90%;

the derivative sequence of SEQ ID NO.2 is preferably obtained by performing 2 or 3 point mutations on the sequence shown in SEQ ID NO. 2;

more preferably, the derivative sequence of SEQ ID NO.2 is an amino acid sequence which is subjected to amino acid substitution at least at position 7 of the sequence shown in SEQ ID NO.2, and the substituted amino acid is preferably asparagine; the substitution of the amino acid sequence shown in SEQ ID NO.2 preferably also occurs at position 6, and the substituted amino acid is preferably serine or alanine; the substitution of the amino acid sequence shown in SEQ ID NO.2 preferably also occurs at position 4, and the substituted amino acid is preferably histidine or arginine;

more preferably, when the amino acid substituted for the 6 th position is serine, the amino acid substituted for the 4 th position is arginine; when the substituted amino acid at the 6 th position is alanine, the substituted amino acid at the 4 th position is histidine;

most preferably, the derivative sequence of SEQ ID NO.2 is shown as any one of SEQ ID NO. 14-17 in the sequence table.

5. A TCR as claimed in claim 4 wherein the amino acid sequence of CDR3 of the TCR α chain variable region is set out in SEQ ID No.3 and the amino acid sequence of CDR3 of the TCR β chain variable region is set out in SEQ ID No. 2; the amino acid sequence of CDR3 of the TCR alpha chain variable region is shown as SEQ ID No.4, and the amino acid sequence of CDR3 of the TCR beta chain variable region is shown as SEQ ID No. 2; the amino acid sequence of CDR3 of the TCR alpha chain variable region is shown as SEQ ID NO.5, and the amino acid sequence of CDR3 of the TCR beta chain variable region is shown as SEQ ID NO. 2; the amino acid sequence of CDR3 of the TCR alpha chain variable region is shown as SEQ ID NO.6, and the amino acid sequence of CDR3 of the TCR beta chain variable region is shown as SEQ ID NO. 2; the amino acid sequence of CDR3 of the TCR alpha chain variable region is shown as SEQ ID No.1, and the amino acid sequence of CDR3 of the TCR beta chain variable region is shown as SEQ ID No. 14; the amino acid sequence of CDR3 of the TCR alpha chain variable region is shown as SEQ ID NO.1, and the amino acid sequence of CDR3 of the TCR beta chain variable region is shown as SEQ ID NO. 15; the amino acid sequence of CDR3 of the TCR alpha chain variable region is shown as SEQ ID NO.1, and the amino acid sequence of CDR3 of the TCR beta chain variable region is shown as SEQ ID NO. 16; the amino acid sequence of CDR3 of the TCR alpha chain variable region is shown as SEQ ID NO.1, and the amino acid sequence of CDR3 of the TCR beta chain variable region is shown as SEQ ID NO. 17; the amino acid sequence of CDR3 of the TCR alpha chain variable region is shown as SEQ ID NO.7, and the amino acid sequence of CDR3 of the TCR beta chain variable region is shown as SEQ ID NO. 2; the amino acid sequence of CDR3 of the TCR alpha chain variable region is shown as SEQ ID NO.8, and the amino acid sequence of CDR3 of the TCR beta chain variable region is shown as SEQ ID NO. 2; the amino acid sequence of CDR3 of the TCR alpha chain variable region is shown as SEQ ID NO.9, and the amino acid sequence of CDR3 of the TCR beta chain variable region is shown as SEQ ID NO. 2; the amino acid sequence of CDR3 of the TCR alpha chain variable region is shown in SEQ ID NO.12, and the amino acid sequence of CDR3 of the TCR beta chain variable region is shown in SEQ ID NO. 2; or, the amino acid sequence of the CDR3 of the TCR alpha chain variable region is shown as SEQ ID No.13, and the amino acid sequence of the CDR3 of the TCR beta chain variable region is shown as SEQ ID No. 2.

6. A TCR as claimed in any one of claims 1 to 5 wherein the TCR α chain variable region or TCR β chain variable region each further comprises one or more of FR1, FR2, FR3 and FR 4;

preferably, the FR1, the FR2 and the FR3 in the TCR α chain variable region are derived from germline TRAV17 or a mutant thereof, and/or the FR4 is derived from germline TRAJ-31 or a mutant thereof;

and/or, said FR1, said FR2, and said FR3 in said TCR β chain variable region are derived from germline TRBV12-4 or a mutant thereof, and/or said FR4 is derived from germline TRBJ2-2 or a mutant thereof;

more preferably:

when the FR1, the FR2 and the FR3 in the TCR alpha chain variable region are derived from germline TRAV17 and the FR4 is derived from germline TRAJ-31, the amino acid sequence of the TCR alpha chain variable region is as set forth in any one of SEQ ID nos. 18-29; when the FR1, the FR2 and the FR3 in the TCR beta variable region are derived from germline TRBV12-4 and the FR4 is derived from germline TRBJ2-2, the amino acid sequence of the TCR beta variable region is as shown in any one of SEQ ID NO. 42-46;

or, when the FR1, the FR2 and the FR3 in the TCR alpha chain variable region are derived from a mutant of germline TRAV17 and the FR4 is derived from a mutant of germline TRAJ-31, the amino acid sequence of the TCR alpha chain variable region is as shown in any one of SEQ ID nos. 30-41; when the FR1, the FR2 and the FR3 in the TCR beta chain variable region are derived from a germline TRBV12-4 mutant and the FR4 is derived from a germline TRBJ2-2 mutant, the amino acid sequence of the TCR beta chain variable region is shown as any one of SEQ ID NO. 47-51; the TCR is preferably ScTCR, and the TCR alpha variable region and the TCR beta variable region in the ScTCR are connected through a linker.

7. A TCR as claimed in any of claims 1 to 6 wherein the TCR α chain and/or TCR β chain of the TCR further comprises a constant region, preferably the TCR α chain constant region is derived from germline TRAC; and/or the constant region of the TCR β chain is preferably derived from germline TRBC 2;

preferably, the TCR α chain and/or TCR β chain of the TCR further comprises an extracellular domain and a transmembrane domain; more preferably, the TCR α chain and/or TCR β chain of the TCR further comprises an intracellular sequence.

8. A nucleic acid encoding a TCR as claimed in any one of claims 1 to 7.

9. A vector, preferably a lentiviral vector, comprising the nucleic acid of claim 8; the nucleic acids encode a TCR α chain and a TCR β chain, respectively, in a single open reading frame, or in two different open reading frames.

10. A cell comprising the nucleic acid of claim 8 or the vector of claim 9; preferably, the cell is a T cell or a stem cell, preferably CD8⁺T cells.

11. An isolated or non-naturally occurring cell, preferably a T cell, presenting a TCR as claimed in any one of claims 1 to 7.

12. A pharmaceutical composition comprising a TCR as claimed in any one of claims 1 to 7 or a cell as claimed in claim 10; preferably, the pharmaceutical composition further comprises a pharmaceutically acceptable carrier.

13. Use of a TCR as claimed in any one of claims 1 to 7, a cell as claimed in claim 10 or 11 or a pharmaceutical composition as claimed in claim 10 in the manufacture of a medicament for the prevention or treatment of a NY-ESO-1 expression-related tumour; preferably, the tumor comprises synovial sarcoma, liposarcoma, myeloid malignant leukemia, malignant melanoma, ovarian cancer, neuroblastoma, prostate cancer, bladder cancer, breast cancer, hepatocellular carcinoma, non-small cell lung cancer, oral squamous carcinoma, and esophageal carcinoma.

Technical Field

The invention belongs to the field of tumor treatment and molecular immunology, and particularly relates to a TCR and application thereof.

Background

NY-ESO-1 belongs to the family of tumor Testis antigens (CTA), which are not expressed in normal tissues, but are very highly expressed in many different types of tumor tissues, such as Testis, ovarian tissues, neuroblastoma (Cancer Res,2003,63,6948), sarcoma (Int J Cancer,2001,94,252), malignant melanoma (Clin Cancer Res,2006,12,764) (PNAS 1997,94, 1914; Int J Cancer 2001,92, 856; Cancer Res.2003,63,6076), as well as higher expression in prostate Cancer, breast Cancer, myeloid malignancies, hepatocellular carcinoma, oral squamous cell carcinoma (Anticancer RES,2009,29,5125), and esophageal Cancer (C1 in Cancer Res,2004,10, 6551).

SLLMWITQC polypeptide of NY-ESO-1 becomes an ideal target for TCR-T cell immunotherapy after being displayed on the cell surface by HLA-A02, and the safety and the primary effectiveness of the target on solid tumors are verified in clinical research and clinical trials (Nat Med.2015,21,914; Clin Cancer Res.2015,21,1019). There are TCR-T immunotherapeutic products against HLA-a x 02/SLLMWITQC targets, some product reports such as CN106632658A, CN106632660A, US2016159881a1, CN108117596, etc., and some related reports on effectiveness and long-term safety of clinical trials (Cancer Discov,2018,8, 944; Blood adv.2019,3,2020). Compared with the traditional methods such as chemotherapy, radiotherapy and the like, the immune product has the advantage of not damaging the normal cells of the immune product, and is an ideal target spot in TCR-T immune cell therapy.

T Cell Receptor (TCR) aiming at autologous testis embryo antigen HLA-A02: 01/SLLMWITQC target point, and affinity K of T cell receptor_DThe value is generally weaker than 10 mu M, so that the tumor cells displaying the polypeptide cannot be effectively killed, and the affinity K of the tumor cells needs to be improved_DTo 0.5/1.0-10 μ M (PNAS,2013.110,6973; Eur.J.Immunol.2012,42,3174;), even 0.1-10 μ M; and the method of in vitro affinity optimization is adopted, so that the affinity is improved, the problems of non-specificity, cross reaction and the like are easily introduced, the mutation meeting the requirements on safety and effectiveness is difficult to obtain. At the same time, due to the diversity of HLA typingThe number of people who benefit from TCR obtained by in vitro affinity optimization methods has certain limitations. Therefore, there is a need for TCRs that are effective, safe, and compatible with multiple HLA-a02:0x (x can be, for example, 1, 3, 9, 12, 16, etc.) typing to expand the therapeutic efficacy and benefit of the population.

Disclosure of Invention

The technical problem to be solved by the invention is to provide a TCR and application thereof in order to overcome the defects that the prior art identifies and combines HLA-A02: 01/SLLMWITQC and can identify the limited number of TCRs of other HLA-A02:0 x. The inventive TCR has high affinity and good safety, and has affinity K for HLA-A02: 01/SLLMWITQC_D0.1 to 10 μ M; the TCR of the invention can bind to other complexes such as HLA-A02: 03/SLLMWITQC, HLA-A02: 09/SLLMWITQC, HLA-A02: 12/SLLMWITQC and HLA-A02: 16/SLLMWITQC, and has a wider applicability.

MHC molecules belong to members of the immunoglobulin superfamily and may be MHC class I or class II molecules. It is specific for antigen presentation, has different MHC among different individuals, and is capable of presenting different short peptides of a protein antigen to the surface of respective Antigen Presenting Cells (APC). Human MHC is commonly referred to as an HLA gene or HLA complex.

The T Cell Receptor (TCR), is the only receptor for a specific antigen presented on the Major Histocompatibility Complex (MHC). In the immune system, the direct physical contact between the T cell and the APC is triggered by the combination of the antigen-specific TCR and the pMHC complex, and then other cell membrane surface molecules of the T cell and the APC interact with each other, which causes a series of subsequent cell signaling and other physiological reactions, so that the T cells with different antigen specificities exert immune effects on target cells of the T cells.

The TCR is a functional unit of T lymphocyte recognition antigen, belonging to immunoglobulin super family, and its coding chain includes four chains of α, β, γ and δ, and is a glycoprotein on the surface of cell membrane in the form of heterodimer formed by α chain/β chain or γ chain/δ chain. 95% of the TCR in peripheral blood is a heterodimer composed of two polypeptide chains, alpha and beta. However, recombinant TCRs may also consist of a single TCR β chain or TCR α chain, which have been shown to be able to bind to antigenic peptide-MHC molecules (WO 2005/113595).

Broadly, each of the α and β chains comprises a variable region, a linker region and a constant region, and the β chain also typically contains a short diversity region between the variable region and the linker region, but the diversity region is often considered to be part of the linker region. Each variable region comprises 3 CDRs (complementarity determining regions) CDR1, CDR2 and CDR3, which are chimeric in framework structures (framework regions). The CDR regions determine the binding of the TCR to the pMHC complex, where CDR3 is recombined from variable and connecting regions, referred to as hypervariable regions. The α and β chains of a TCR are generally regarded as having two "domains" each, namely a variable domain and a constant domain, the variable domain being made up of linked variable regions and linking regions. The sequences of TCR constant domains can be found in public databases of the international immunogenetic information system (IMGT), such as the constant domain sequence of the α chain of the TCR molecule is TRAC (also known as TRAC × 01), the constant domain sequence of the β chain of the TCR molecule is TRBC1 (also known as TRBC1 × 01) or TRBC2 (also known as TRBC2 × 01). In addition, the α and β chains of the TCR also comprise a transmembrane region and a cytoplasmic region, the cytoplasmic region being very short.

In addition, the alpha chain consists of TRAV, TRAJ, TRAC rearrangements in germline genes; the beta chain is composed of TRBV, TRBD, TRBJ and TRBC rearrangement in the germ line gene, after different V (D) J are retapped, a variable region (N) is formed by random insertion of different numbers of nucleotides when V-J (or V-D and D-J) are connected to form a complementarity determining region 3(CDR3), and the random insertion enables TCR alpha chain and beta chain sequences to present high diversity; the CDR3 differs in length and base sequence when TCRs of different clone T lymphocytes rearrange, which is the region where the TCR specifically recognizes the antigen, which determines the specificity of the TCR.

In addition: in addition to the mutations explicitly specified in the present invention, there are conservative modifications or conservative substitutions or substitutions well known in the art. Such conservative modifications or such conservative substitutions or substitutions refer to the replacement of amino acids in a protein with other amino acids having similar characteristics (e.g., charge, side chain size, hydrophobicity/hydrophilicity, backbone conformation, and rigidity, etc.) so that changes may be made frequently without altering the biological activity of the protein. It is known to The person skilled in The art that, in general, a single amino acid substitution in a non-essential region of a polypeptide does not substantially alter The biological activity (see, for example, Watson et al (1987) molecular μ lar Biology of The Gene, The Benjamin/Cummings Pub. Co., p. 224, (4 th edition)). In addition, substitution of structurally or functionally similar amino acids is unlikely to abolish biological activity. Common conservative substitutions of amino acids are as follows:

the present inventors have found, through a number of experiments, a novel wild-type (native) TCR capable of specifically recognizing HLA-A02: 01/SLLMWITQC. Based on the T cell receptor, the inventors used protein engineering methods to obtain stably folded scTCR mutant sequences. By adopting the scTCR sequence, a series of affinity Ks are obtained through phage display_DA high affinity and safe heterodimeric TCR mutant of 0.1-10 μ M; it has also been surprisingly found that it also recognizes other distinct HLA-a x 02 targets, with broader applicability. Further, these mutants were transduced to CD8 by lentiviruses⁺After T cells, specific killing activity against various tumor cell lines was exhibited.

The invention mainly solves the technical problems through the following technical scheme.

The invention provides a TCR comprising a TCR alpha chain variable region and/or a TCR beta chain variable region, the TCR being capable of specifically recognizing and binding HLA-A02: 01/SLLMWITQC, the TCR having affinity K for HLA-A02: 01/SLLMWITQC_D10.1 to 10 μ M; the TCR can also specifically recognize and bind one or more of HLA-A02: 03/SLLMWITQC, HLA-A02: 09/SLLMWITQC, HLA-A02: 12/SLLMWITQC and HLA-A02: 16/SLLMWITQC, and has affinity K_D2Is 0.1 to 85 μ M, preferably 0.57 to 27 μ M, and more preferably 1.3 to 10 μ M.

Wherein: affinity K of said TCR for said HLA-A02: 01/SLLMWITQC_D0.39 to 9.3. mu.M, for example 6.5. mu.M; more preferably, said affinity K_D0.81 to 3.2. mu.M, such as 2.1. mu.M, 3.2. mu.M, 3.9. mu.M, 4.3. mu.M or4.9. mu.M;

affinity K of said TCR to said HLA-A02: 16/SLLMWITQC_DPreferably 0.16 to 23. mu.M, such as 4.1. mu.M, 5. mu.M, 5.2. mu.M, 6.1. mu.M, 8.2. mu.M, 11. mu.M or 15. mu.M, more preferably 1.3 to 12. mu.M;

affinity K of said TCR to said HLA-A02: 03/SLLMWITQC_DPreferably 1.1 to 76. mu.M, such as 6.6. mu.M, 8.3. mu.M, 13. mu.M, 16. mu.M, 18. mu.M, 21. mu.M, 22. mu.M or 24. mu.M; more preferably 2.3 to 9 μ M;

affinity K of said TCR to said HLA-A02: 09/SLLMWITQC_DPreferably 0.1 to 8.3. mu.M, such as 6.4. mu.M, more preferably 0.51 to 5.6. mu.M, still more preferably 0.57 to 3. mu.M, such as 1.4. mu.M, 1.7. mu.M or 2.4. mu.M;

affinity K of said HLA-A02: 12/SLLMWITQC_DPreferably 0.88 to 85. mu.M, such as 13. mu.M, 22. mu.M, 24. mu.M, 27. mu.M, 31. mu.M or 58. mu.M; more preferably 3 to 35. mu.M, still more preferably 5.1 to 10. mu.M [ the method for measuring affinity is Surface Plasmon Resonance (SPR), abbreviated as SPR)]。

Preferably, the TCR is capable of specifically recognizing and binding HLA-A02: 09/SLLMWITQC and/or HLA-A02: 12/SLLMWITQC; alternatively, the TCR may be capable of specifically recognising and binding HLA-A02: 03/SLLMWITQC and/or HLA-A02: 16/SLLMWITQC.

Increasing The binding affinity of native TCRs generally decreases The specificity of The TCR for its peptide-MHC ligand, as demonstrated in Zhao Yangbing et al, The Journal of Immunology, The American Association of Immunologists, US, vol.179, No.9,2007, 11.1.11.5-. However, the TCRs of the invention retain specificity for the complex, despite having a higher binding affinity.

More preferably, the amino acid sequences of CDR1, CDR2 and CDR3 of the α chain variable region of said TCR are shown in SEQ ID NO.71, SEQ ID NO.72 and SEQ ID NO.1, respectively, or in the derivative sequences of SEQ ID NO.71, SEQ ID NO.72 and SEQ ID NO.1, respectively; wherein:

the identity of the derived sequence of SEQ ID NO.71 and the sequence shown in SEQ ID NO.71 is preferably 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or more than 99%.

The identity of the derived sequence of SEQ ID NO.72 and the sequence shown in SEQ ID NO.72 is preferably 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or more than 99%.

The identity of the derived sequence of SEQ ID NO.1 and the sequence shown in SEQ ID NO.1 is preferably 55% or more, more preferably 66.67% or more, still more preferably 77.78% or more, and still more preferably 88.89% or more. The derivative sequence of SEQ ID NO.1 is preferably obtained by performing 1,2, 3 or 4 point mutation on the sequence shown in SEQ ID NO.1, more preferably an amino acid sequence obtained by performing amino acid substitution at least at the 2 nd position of the sequence shown in SEQ ID NO.1, wherein the substituted amino acid is an aromatic amino acid; according to the general knowledge in the art, the aromatic amino acid includes tyrosine (Y), phenylalanine (F) and tryptophan (W), and in the present invention, the aromatic amino acid is preferably tyrosine (Y) or phenylalanine (F) in order to enhance the affinity of the TCR. To further enhance the affinity of the TCR, the substitutions made to the amino acid sequence shown in SEQ ID No.1 preferably also occur at positions 1,4 and/or 5; more preferably, when the amino acid after the substitution at position 2 is tyrosine (Y), the substitution for the amino acid sequence shown in SEQ ID No.1 also occurs at positions 1,4 and/or 5; when the amino acid substituted at the 2 nd position is phenylalanine (F), the substitution aiming at the amino acid sequence shown in SEQ ID NO.1 also occurs at the 5 th position; the substituted amino acid is preferably valine (V) with respect to the 1 st position; the substituted amino acid is preferably glutamic acid (E), valine (V) or alanine (A) at the 4 th position; the substituted amino acid at the 5-position is preferably histidine (H), asparagine (N), tryptophan (W) or alanine (A). Most preferably, the derived sequence of SEQ ID NO.1 is shown as any one of SEQ ID NO. 3-13 in the sequence table.

In the present invention, the amino acid sequences of CDR1, CDR2 and CDR3 of the β chain variable region of said TCR are preferably represented by SEQ ID No.73, SEQ ID No.74 and SEQ ID No.2, respectively, or by the derived sequences of SEQ ID No.73, SEQ ID No.74 and SEQ ID No.2, respectively; more preferably:

the identity of the derived sequence of SEQ ID NO.73 and the sequence shown in SEQ ID NO.73 is 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or more than 99%.

The identity of the derived sequence of SEQ ID NO.74 and the sequence shown in SEQ ID NO.74 is 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or more than 99%.

The identity of the derived sequence of SEQ ID NO.2 and the sequence shown in SEQ ID NO.2 is more than 70%, preferably more than 80%, and more preferably more than 90%.

The derivative sequence of SEQ ID NO.2 is preferably obtained by performing 2 or 3 point mutations on the sequence shown in SEQ ID NO. 2;

even more preferably, the derivative sequence of SEQ ID No.2 is an amino acid sequence with an amino acid substitution at least at position 7 of the sequence shown in SEQ ID No.2, preferably asparagine (N) for enhancing the affinity of the TCR; to further enhance the affinity of the TCR, the substitution of the amino acid sequence shown in SEQ ID No.2, preferably serine (S) or alanine (a), also occurs at position 6. The substitution preferably also takes place in position 4 for the amino acid sequence shown in SEQ ID No.2, the amino acid after the substitution preferably being histidine (H) or arginine (R). Preferably, when the amino acid substituted for the 6 th position is serine (S), the amino acid substituted for the 4 th position is arginine (R); when the amino acid substituted for the 6 th position is alanine (a), the amino acid substituted for the 4 th position is histidine (H). More preferably, the derivative sequence of SEQ ID NO.2 is shown as any one of SEQ ID NO. 14-17 in the sequence table.

Preferably, the amino acid sequence of CDR3 of the TCR α chain variable region is as shown in SEQ ID No.3, and the amino acid sequence of CDR3 of the TCR β chain variable region is as shown in SEQ ID No. 2; the amino acid sequence of CDR3 of the TCR alpha chain variable region is shown as SEQ ID No.4, and the amino acid sequence of CDR3 of the TCR beta chain variable region is shown as SEQ ID No. 2; the amino acid sequence of CDR3 of the TCR alpha chain variable region is shown as SEQ ID NO.5, and the amino acid sequence of CDR3 of the TCR beta chain variable region is shown as SEQ ID NO. 2; the amino acid sequence of CDR3 of the TCR alpha chain variable region is shown as SEQ ID NO.6, and the amino acid sequence of CDR3 of the TCR beta chain variable region is shown as SEQ ID NO. 2; the amino acid sequence of CDR3 of the TCR alpha chain variable region is shown as SEQ ID No.1, and the amino acid sequence of CDR3 of the TCR beta chain variable region is shown as SEQ ID No. 14; the amino acid sequence of CDR3 of the TCR alpha chain variable region is shown as SEQ ID NO.1, and the amino acid sequence of CDR3 of the TCR beta chain variable region is shown as SEQ ID NO. 15; the amino acid sequence of CDR3 of the TCR alpha chain variable region is shown as SEQ ID NO.1, and the amino acid sequence of CDR3 of the TCR beta chain variable region is shown as SEQ ID NO. 16; the amino acid sequence of CDR3 of the TCR alpha chain variable region is shown as SEQ ID NO.1, and the amino acid sequence of CDR3 of the TCR beta chain variable region is shown as SEQ ID NO. 17; the amino acid sequence of CDR3 of the TCR alpha chain variable region is shown as SEQ ID NO.7, and the amino acid sequence of CDR3 of the TCR beta chain variable region is shown as SEQ ID NO. 2; the amino acid sequence of CDR3 of the TCR alpha chain variable region is shown as SEQ ID NO.8, and the amino acid sequence of CDR3 of the TCR beta chain variable region is shown as SEQ ID NO. 2; the amino acid sequence of CDR3 of the TCR alpha chain variable region is shown as SEQ ID NO.9, and the amino acid sequence of CDR3 of the TCR beta chain variable region is shown as SEQ ID NO. 2; the amino acid sequence of CDR3 of the TCR alpha chain variable region is shown in SEQ ID NO.12, and the amino acid sequence of CDR3 of the TCR beta chain variable region is shown in SEQ ID NO. 2; or, the amino acid sequence of the CDR3 of the TCR alpha chain variable region is shown as SEQ ID No.13, and the amino acid sequence of the CDR3 of the TCR beta chain variable region is shown as SEQ ID No. 2.

The variable regions of the TCR α and TCR β chains, which are conventional in the art, are composed of 3 CDR regions and 4 FR regions, arranged in sequence from amino terminus to carboxy terminus: FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR 4. The TCR α chain variable region of the invention may also further comprise one or more of CDR1, CDR2, FR1, FR2, FR3 and FR 4; the TCR β chain variable region of the present invention may also further comprise one or more of CDR1, CDR2, FR1, FR2, FR3, and FR 4;

preferably, the CDR1, the CDR2, the FR1, the FR2 and the FR3 in the TCR a chain variable region are derived from germline TRAV17 or a mutant thereof, and/or the FR4 is derived from germline TRAJ-31 or a mutant thereof; said CDR1, said CDR2, said FR1, said FR2 and said FR3 in said TCR β chain variable region are derived from germline TRBV12-4, and/or said FR4 is derived from germline TRBJ2-2 or a mutant thereof;

the mutations, which are usually made for the purpose of in vitro renaturation or stability of artificially prepared TCRs, in particular single chain (ScTCR-wt), soluble TCRs (i.e., the extracellular domain of TCR that can be combined with other molecules, such as anti-D3 antibody, to redirect T cells), the scTCRs (TCR. alpha. chain variable region and TCR. beta. chain variable region constructed by short peptide linkers) that are preferred embodiments of the present invention, occur mainly in the framework regions of the TCR. alpha. chain variable region and the TCR. beta. chain variable region, according to common knowledge in the art.

More preferably:

when the CDR1, the CDR2, the FR1, the FR2 and the FR3 in the TCR a chain variable region are derived from germline TRAV17 and the FR4 is derived from germline TRAJ-31, the amino acid sequence of the TCR a chain variable region is as set forth in any one of SEQ ID nos. 18-29; when the CDR1, the CDR2, the FR1, the FR2 and the FR3 in the TCR beta chain variable region are derived from germline TRBV12-4 and the FR4 is derived from germline TRBJ2-2, the amino acid sequence of the TCR beta chain variable region is as shown in any one of SEQ ID NO. 42-46;

alternatively, when the CDR1, the CDR2, the FR1, the FR2 and the FR3 in the TCR α chain variable region are derived from a mutant of germline TRAV17, and the FR4 is derived from a mutant of germline TRAJ-31, wherein the mutation site is in the sequence shown in SEQ ID No.18, preferably at one or more of positions 21, 45, 46, 90, 94, 96, 126 and 128 according to the IMGT rules. Wherein: the 21 st position is preferably mutated into isoleucine (I); the 45 th position is preferably mutated into aspartic acid (D); the 46 th position is preferably mutated into proline (P); the 90 th position is preferably mutated into glutamic acid (E); the 94 th position is preferably mutated into threonine (T); the 96 th position is preferably mutated into proline (P); the 126 th position is preferably mutated into threonine (T); the 128 th position is preferably mutated to asparagine (N). In a preferred embodiment of the present invention, the amino acid sequence of the TCR alpha chain variable region is as shown in any one of SEQ ID No. 30-41.

When the CDR1, the CDR2, the FR1, the FR2 and the FR3 in the TCR beta variable region are derived from a mutant of germline TRBV12-4 and the FR4 is derived from a mutant of germline TRBJ2-2, the mutation sites are preferably located at one or more of positions 5, 11-15, 45-47, 86 and 128 in the sequence shown in SEQ ID NO.42 according to the IMGT rules. Wherein, the 5 th preferred mutation is (T); the 11 th position is preferably mutated into isoleucine (I); the 12 th position is preferably mutated into threonine (T); the 13 th position is preferably mutated into valine (V); the 14 th position is preferably mutated to proline (P); the 15 th position is preferably mutated into glutamine (Q); the 45 th position is preferably mutated into aspartic acid (D); the 46 th position is preferably mutated into proline (P); the 47 th position is preferably mutated into glycine (G); the 86 th position is preferably mutated into histidine (H); the 128 th position is preferably mutated to asparagine (N). In a preferred embodiment of the present invention, the amino acid sequence of the TCR β chain variable region is as shown in any one of SEQ ID No. 47-51.

The TCRs of the invention may be in α β heterodimeric or single chain form. The single chain form includes an α β TCR polypeptide of the type V α -L-V β, V β -L-V α, V α -C α -L-V β or V α -L-V β -C β (where V α and V β are TCR α and TCR β variable regions, respectively, C α and C β are TCR α and TCR β constant regions, respectively, and L is a linker sequence).

The TCR is preferably scTCR, and the TCR alpha variable region and the TCR beta variable region in the scTCR are connected through a joint; the sequence of the linker may be conventional in the art, in antibody engineering andTCR engineering is often used. The Linker sequence common to the TCR field is (GGGSE)₄GGTG(Immunology,2018,155,123；CN109400696A)、GSADDAKKDAAKKDGKS(PNAS,1992,89,4759；PNAS,2005,102,19033；Protein Eng.2011,24,361；WO2011044186A1)、PGGG-(SGGGG)₅P (WO2004033685A1), preferably such as P (GGGGS)₃(PNAS,1994,91, 12654; Cancer Gene ther.,2004,11, 487).

It is noted that the determination of the position of the CDRs 1-3 and FR 1-4 in the full length TCR sequences of the invention is defined by the IMGT (International Immunogenetic information System) nomenclature, which is well known and found in the IMGT public data, "T cell Receptor facebook, (2001) LeFranc and LeFanc, Acdamic Press, ISBN 0-12-441352-8" also discloses sequences defined by the IMGT nomenclature, specifically: FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4 of the TCR alpha chain are respectively positioned at the 1 st to 26 th, 27 th to 38 th, 39 th to 55 th, 56 th to 65 th, 66 th to 104 th, 105 th to 117 th and 118 th to 128 th of the TCR alpha chain variable region shown as SEQ ID NO.18 in sequence; FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4 of the TCR beta chain are respectively positioned at positions 1-26, 27-38, 39-55, 56-65, 66-104, 105-117 and 118-128 of the TCR beta chain variable region shown in SEQ ID NO. 42.

The TCR α chain and the TCR β chain, which are conventional in the art, are composed of a variable region and a constant region. The TCR α chain and/or TCR β chain of the TCRs described herein may also further comprise a constant region, the constant region of the TCR α chain being derived from a germline TRAC; and/or the constant region of the TCR β chain is derived from germline TRBC 2; wherein, the link of the TCR alpha chain has two amino acids P and N, and the amino acids belong to the natural TCR alpha chain. Preferably, the TCR further comprises an extracellular domain and a transmembrane domain; more preferably, the TCR further comprises an intracellular sequence.

Unless otherwise specified, the N-terminus of the amino acid sequence of the TCR described herein is a methionine residue. As is well known to those skilled in the art, the methionine is removed during the production of the recombinant protein.

The invention also provides a nucleic acid encoding a TCR as described above.

The invention also provides a vector comprising a nucleic acid as described above, said virus preferably being a lentiviral vector; the nucleic acids encode a TCR α chain and a TCR β chain, respectively, in a single open reading frame, or in two different open reading frames.

The invention also provides a cell comprising a nucleic acid as described above or a vector as described above; preferably, the cell is a T cell or a stem cell, preferably CD8⁺T cells.

The invention also provides an isolated or non-naturally occurring cell, preferably a T cell, presenting a TCR as described above.

The invention also provides a pharmaceutical composition comprising a TCR as described above or a cell as described above; preferably, the pharmaceutical composition further comprises a pharmaceutically acceptable carrier.

The invention also provides the application of the TCR, the cell or the pharmaceutical composition in preparing a medicament for preventing and treating NY-ESO-1 expression-related tumors; preferably, said NY-ESO-1 related tumor comprises synovial sarcoma, liposarcoma, myeloid malignant leukemia, malignant melanoma, ovarian cancer, neuroblastoma, prostate cancer, bladder cancer, breast cancer, hepatocellular carcinoma, non-small cell lung cancer, oral squamous cell carcinoma, and esophageal cancer.

Attention is paid to: the number "1" or "2" following the term in the present invention, for example K_D1And K_D2"1" and "2" in (A) are not practical meanings, but merely distinguish the same terms.

On the basis of the common knowledge in the field, the above preferred conditions can be combined randomly to obtain the preferred embodiments of the invention.

The reagents and starting materials used in the present invention are commercially available.

The positive progress effects of the invention are as follows:

the inventive TCR has high affinity and good safety, and has affinity K for HLA-A02: 01/SLLMWITQC_D10.1-10 μ M; in additionIn addition, the TCR of the invention can bind to other complexes such as HLA-A02: 03/SLLMWITQC, HLA-A02: 09/SLLMWITQC, HLA-A02: 12/SLLMWITQC and HLA-A02: 16/SLLMWITQC, with affinity K_D2Can reach 0.1-85 μ M, even 0.57-27 μ M, and has wider applicability. Further, these mutants were transduced to CD8 by lentiviruses⁺After T cells, the specific killing activity to various tumor cell lines is shown, and the application prospect is good.

Drawings

FIG. 1 shows that double positive clone cells are detected by sorting.

FIGS. 2A and 2B show NY^c9After renaturation of scTCR-wt, the renaturation fails by anion exchange chromatography and SDS-Page electrophoresis.

FIGS. 3A and 3B show NY^c9Anion exchange chromatography and SDS-Page electrophoresis after renaturation of scTCR _ X0.

FIGS. 4A and 4B show NY^c9And (4) gel filtration chromatography and SDS-Page electrophoresis are carried out after the renaturation of the scTCR _ X0, and the purification is successful.

FIG. 5 shows NY^c9Affinity testing for scTCR _ X0 and HLA-A02: 01/SLLMWITQC.

FIG. 6 shows the inclusion body purification scheme.

FIG. 7A and FIG. 7B are NY^c9Anion exchange chromatography and non-reducing SDS-PAGE electrophoresis of A5B 0.

FIG. 8A and FIG. 8B are NY^c9Gel filtration chromatography and SDS-PAGE of A5B 0.

FIGS. 9A and 9B are graphs obtained by performing anion exchange chromatography and SDS-PAGE on HLA-A02: 01/. beta.2M/SLLMWITQC renaturation.

FIGS. 10A and 10B are HLA-A02: 01/. beta.2M/SLLMWITQC gel filtration chromatography and SDS-PAGE electrophoresis; wherein the band with large molecular weight is HLA-A02: 01, the band with small molecular weight is beta 2M, the molecular weight of SLLMWQC is too small, and the band can not be seen on SDS-PAGE.

FIG. 11 is a Gel Shift plot after pMHC biotinylation.

FIG. 12 is NY^c9Affinity test patterns of-A5B 0 with HLA-A02: 01/SLLMWITQC.

FIG. 13 is NY^c9The lentivirus infection effect of A5B 0.

FIG. 14 is NY^c9INF- γ Release profiles of A2B0, A3B0, and A5B 0.

FIG. 15 is a tumor cell line specific LDH killing experiment.

FIG. 16 shows the growth of the tumor in mice after 22 days of tumor cell and T cell inoculation; the arrows indicate the location of the tumor.

FIG. 17 is a tumor growth curve.

FIG. 18 is NY^c9Data on INF- γ release from A5B0 on 10 HLA-a02: 01 typed PBMCs from healthy humans.

FIG. 19 is NY^c9Data on INF- γ release from A5B0 on 30 non-HLA-a 02:01 typed PBMCs from healthy humans.

FIG. 20 is NY^c9INF- γ release data from A5B0 on 5 embryonic primary cells.

FIG. 21 is NY^c9INF- γ release data from A5B0 on different HLA-a x 02:0x typing.

FIG. 22 shows transfection of NY^c9TCR-T cells of A5B0 did not significantly recognize Human Astrocytes (HA) transfected with different HLA-a02:0x types.

FIG. 23 is a photograph of NY transfected cells^c9TCR-T cells of A5B0 did not significantly recognize Human Lung Fibroblasts (HLFs) transfected with different HLA-a02:0x typing.

FIG. 24 is a photograph of NY transfected cells^c9TCR-T cells of A5B0 did not significantly recognize human embryonic hepatocytes (CCC-HEL) transfected with different HLA-A02:0X types.

FIG. 25 shows transfection of NY^c9TCR-T cells of A5B0 did not significantly recognize human embryonic lung cells (CCC-HPF) transfected with different HLA-A02:0X types.

FIGS. 26A to 26P show lentiviral vector sequences when A0B0, A1B0, A2B0, A3B0, A4B0, A5B0, A6B0, A7B0, A8B0, A9B0, A10B0, A11B0, A0B1, A0B2, A0B3 and A0B4 are expressed, respectively.

Detailed Description

The invention is further illustrated by the following examples, which are not intended to limit the scope of the invention. The experimental methods without specifying specific conditions in the following examples were selected according to the conventional methods and conditions, or according to the commercial instructions.

The inventive TCR was obtained by the following experimental procedure:

1. specific CD8⁺Cloning T cells to obtain a heterodimer TCR sequence;

2. (ii) engineering the stability of the scTCR domain against the TCR;

3. adopting the modified scTCR sequence to carry out phage display to obtain high-affinity CDR3 alpha and CDR3 beta sequence mutation;

4. introduction of these mutations into heterodimeric TCRs corresponding TCRs were prepared in vitro and tested for affinity to pMHC of specific target HLA A02:01/SLLMWITQC, requiring K_DThe value is within the range of 0.1-10 mu M;

5. preparing a series of specific target point HLA-A02: 01/SLLMWITQC mutants, further testing the affinity of the specific target point HLA-A02: 01/SLLMWITQC mutants, and obtaining high-affinity heterodimer TCR mutants with good specificity from a biochemical aspect;

6. high affinity heterodimers with good specificity, further made into lentiviruses and infected with CD8⁺T cells, obtaining CD8 capable of recognizing specific expression HLA-A02: 01/SLLMWITQC target⁺A T cell;

7. the modified CD 8T cell is used for carrying out in-vitro tumor cell line specificity killing test to finally obtain the heterodimer TCR mutation sequence capable of effectively and specifically killing the tumor cell.

After obtaining the above TCR, in vivo tumor killing experiments were performed on animals.

See the examples below for details.

The following examples are given in NY^c9A5B0(NY refers to the protein name of NY-ESO-1, c9 refers to monoclonal CD8 growing from the hole⁺T cell) as an example, the preparation of the inventive TCR is described in detail.

In addition: in the following examples, cell lines were purchased from ATCC unless otherwise specified.

Example 1 clone-specific CD8⁺T cells, obtaining heterodimersTCR sequence (acquisition and characterization of wild-type TCR)

Methods, reagents and consumables for T cell cloning, reference is made mainly to curr. PLoS One, 2011,6, e 27930; onco Immunology 2016,5, e1175795 and references cited therein. B-cells (EBV-B) loaded with NY-ESO-1 short peptide (SLLMWITQC) transduced with EBV (EB Virus) (J Vis exp.2011, 8,3321) (EBV Virus: ATCC product No. VR-1492) stimulated HLA-A02: 01 genotype of healthy volunteers CD8⁺T cells. Among them, the culture method of monoclonal T cells mainly refers to the work of the related literature (J immunological methods.2006,310, 40; PLoS one.2014,9, e 110741). Double positive T cells were sorted using PE-labeled short peptide-HLA tetramer (MBL, product No. TS-M047-1) and APC-labeled anti-CD 8 antibody (Biolegend, product No. 301014). T cells stimulated by SLLMWITQC short peptide were expanded to 5000-10000 cells and sorted. After 2-3 times of stimulation culture and sorting, the cells are subjected to limiting dilution to about 0.5 cell/well and then cultured to obtain a monoclonal (refer to doctor's paper of Cardiff University pharmacy, Lissina A.2011, timing of T cell receptor anti-orientation for targeting separation), and the proliferated monoclonal T cells are used for subsequent tetramer staining sorting. As shown in FIG. 1, the detected double positive clone cells were sorted and Quick-RNA was used as a kit^TMMiniPrep (ZYMO research, product No. R1050) extracts total RNA from the sorted monoclonal T cells. The mRNA was further reverse transcribed into cDNA and the sequence was cloned into pUC19(Invitrogen, product number SD0061) using the SMART RACE cDNA amplification kit from Clontech and sequenced.

Finally obtaining wild type TCR, and obtaining the total length composition of alpha chain and beta chain after sequence identification and analysis of the wild type TCR:

full length of alpha chain:

METLLGVSLVILWLQLARVNSQQGEEDPQALSIQEGENATMNCSYKTSINNLQWYRQNSGRGLVHLILIRSNEREKHSGRLRVTLDTSKKSSSLLITASRAADTASYFCASDQDARLMFGDGTQLVVKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLSVIGFRILLLKVAGFNLLMTLRLWSS(SEQ ID NO.52)。

full length of beta chain:

MDSWTLCCVSLCILVAKHTDAGVIQSPRHEVTEMGQEVTLRCKPISGHDYLFWYRQTMMRGLELLIYFNNNVPIDDSGMPEDRFSAKMPNASFSTLKIQPSEPRDSAVYFCASSLGPGELFFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGFTSESYQQGVLSATILYEILLGKATLYAVLVSA LVLMAMVKRKDSRG(SEQ ID NO.53)。

in the above full-length sequence of the α chain or β chain: the underlined parts are the signal peptide sequence, the unlabeled sequence is the V.alpha. (variable region of the alpha chain; sequence shown in SEQ ID NO. 18) or V.beta. (variable region of the beta chain; sequence shown in SEQ ID NO. 42), the bold part is the C.alpha. (constant region of the alpha chain) or C.beta. (constant region of the beta chain) sequence, the italic part is the extracellular linker, the italic part is the transmembrane region and the intracellular sequence. According to the IMGT rule, FR1, CDR1(SEQ ID NO.71), FR2, CDR2(SEQ ID NO.72), FR3, CDR3(SEQ ID NO.1) and FR4 of the TCR alpha chain are respectively located at positions 2-27, 28-32, 33-49, 50-56, 57-90, 91-99 and 100-109 of the TCR alpha chain variable region shown in SEQ ID NO. 18; FR1, CDR1(SEQ ID NO.73), FR2, CDR2(SEQ ID NO.74), FR3, CDR3(SEQ ID NO.2) and FR4 of the TCR beta chain are respectively located at positions 1 to 26, 27 to 31, 32 to 48, 49 to 54, 55 to 92, 93 to 102 and 103 to 112 of the TCR beta chain variable region having the sequence shown in SEQ ID NO. 42.

The transmembrane region and intracellular sequence (in italics and underlined) of the full length of the alpha chain and the full length of the beta chain were removed, respectively, to obtain A0 whose amino acid sequence is shown in SEQ ID NO.54 and B0 whose amino acid sequence is shown in SEQ ID NO.66 (wherein "A" and "B" represent the alpha chain and the beta chain, respectively, and "0" represents no mutation).

Example 2 stability engineering of scTCR Domain against the wild-type TCR prepared in example 1

The V.alpha.and V.beta.obtained in example 1 (the variable region sequences of the alpha chain full length and the beta chain full length are shown in SEQ ID NO.18 and SEQ ID NO.42, respectively) were linked by Linker amino acid sequences to obtain wild type scTCR (hereinafter scTCR-wt), which is very unstable and needs stability optimization for affinity optimization (PNAS,1999,96, 5651; Nat Biotechnol.,2000,18, 754; Front. Oncol.,2015,4, 1; WO2016124142) and inclusion body renaturation (cloning, expression and purification of scTCR-wt according to conventional methods in the art).

For the beta-turn structure of scTCR-wt, mutations contributing to the stability of the beta-turn structure are introduced according to the preference of different amino acid side chains to different positions of the beta-turn. Due to the removal of the C α, C β domains, hydrophobic amino acids at some positions in the V α, V β domains are exposed at the surface, reducing amino acid mutations of the hydrophobic character of the surface, resulting in a stable scTCR _ X0 sequence. The genes were directly synthesized for scTCR-wt and scTCR-X0 and then cloned into pET28a vector by Nco I/Not I endonuclease.

The scTCR _ X0 obtained by stability modification has mutations in FR1, FR2, FR3 and FR4 regions of a TCR alpha chain and a TCR beta chain, particularly in a sequence shown in SEQ ID NO.18, and is preferably positioned at one or more of positions 21, 45, 46, 90, 94, 96, 126 and 128 according to the IMGT rule; in the sequence shown in SEQ ID NO.42, it is preferably located at one or more of positions 5, 11 to 15, 45 to 47, 86 and 128 according to the IMGT rules. Thereby obtaining a variable region after the A0 framework mutation (the sequence is shown as SEQ ID NO. 30) and a variable region after the B0 framework mutation (the sequence is shown as SEQ ID NO. 47). The variable region after the A0 framework mutation and the variable region after the B0 framework mutation are connected with a peptide Linker sequence P (GGGGS)₃(ii) a Hereinafter, both are referred to as Linker sequences or linkers) to obtain scTCR _ X0[ the amino acid sequence is shown as SEQ ID NO.30+ Linker sequence + SEQ ID NO.47 (the left is N end, the right is C end; if not mentioned, the following are left N and right C)]。

Inclusion body expression, protein renaturation, purification and affinity testing of scTCR-wt and scTCR-X0 were performed as described in example 4, example 5 and example 7, and the results are shown in fig. 2A, fig. 2B, fig. 3A, fig. 3B, fig. 4A, fig. 4B and fig. 5.

Example 3 phage display

Adopting Nco I/Not I enzyme cutting sites, inserting the gene of the engineered scTCR into a phage display carrier to be used as a phage display library construction template, designing discontinuous mutation primers for the variable region CDR3 alpha/CDR 3 beta, electrically transferring the mutant primers into TG1 competence for 2-3 subsequent rounds of phage screening. The overall process of phage selection, in addition to the conventional Molecular biology handbook, is mainly referred to two articles, Nature Protocols,2007,2,3001 and Nat. Biotech.2005,23,349, a Ph.Stokes of Cardiff University medicine (Liddy S.2013, Molecular engineering of high affinity T-cell receptors for biological therapeutics).

Library screening: the library bacteria were inoculated into 30-50 mL of 2 XYT medium containing 100. mu.g/mL ampicillin and 2% glucose, OD after inoculation₆₀₀Culturing at 37 deg.C and 200-220 rpm until OD is 0.05-0.08%₆₀₀＝0.4～0.5。

Adding the helper phage according to the ratio (molar ratio) of 15: 1-25: 1 (phage: bacteria), uniformly mixing, and standing for 30 minutes at 37 ℃; after centrifugation at room temperature for 10 minutes at low speed, the supernatant was discarded and resuspended in 30-50 mL of 2 XYT medium supplemented with 100. mu.g/mL ampicilin + 50. mu.g/mL kanamycin, and incubated at 26 ℃ and 200-220 rpm overnight.

Centrifuging the bacteria culture solution at 4 deg.C for 10min, collecting supernatant and PEG/NaCl solution, mixing at 4:1, ice-cooling for 1 hr, centrifuging at 4 deg.C for 10min, and collecting precipitate. Resuspending with 10ml PBS, centrifuging at 4 ℃ for 10min at high speed, collecting supernatant, adding 2.5ml PEG/NaCl solution, mixing uniformly, and carrying out ice bath for 20-30 min; centrifugation was carried out at 4 ℃ for 30 minutes, and the pellet was resuspended in 1mL of PBS to obtain a phage solution.

Taking a proper volume of the phage solution, adding 3% (w/v) milk solution for sealing for 1 hour, adding a proper amount of biotinylated pMHC solution, incubating at room temperature, reacting for 1 hour to form a phage-pMHC complex, and then adding 50 mu l of streptavidin magnetic beads to further form a magnetic bead-phage-pMHC complex.

Adsorbing the magnetic beads by a magnet, fully washing for 3-5 times, adding 0.1mg (final concentration is 1mg/mL) of pancreatin, reacting for 30 minutes at room temperature, taking supernatant after the magnetic adsorption, infecting a pre-activated TG1 strain, coating a plate, and culturing overnight at 30 ℃ in an inverted manner. And repeating the processes for the second and third rounds of screening according to experimental requirements.

Phage ELISA experiments: referring to the work flow of Nature Protocols,2007,2,3001, a single clone was picked up into 150mL of 2 XYT medium (100. mu.g/mL ampicilin and 2% glucose) and cultured overnight at 37 ℃ at 200-220 rpm. Transferring 2-5 μ L of the bacterial suspension from each clone to a new 96-well plate containing 150-200 μ L of the same culture medium, and culturing at 37 ℃ and 200-220 rpm for 3 hours. Then 50. mu.l of helper phage was added to each well at a sufficient titer and incubated at 37 ℃ for 1 hour at 200-220 rpm. The pellet was collected after centrifugation at low speed for 10 minutes at room temperature and then resuspended in 200. mu.L (2 XYT medium supplemented with 100. mu.g/mL ampicilin + 50. mu.g/mL kanamycin); culturing at 26 ℃ and 200-220 rpm overnight.

A96-well ELISA plate was prepared by adding 1. mu.g of streptavidin to each well, allowing the plate to stand overnight in a refrigerator at 4 ℃ and then washing the plate with PBS 3 times, adding 0.5. mu.g (volume concentration) of biotin-labeled pMHC, and reacting the plate at room temperature for 30 minutes. 400 μ L of 6% milk in PBS was added and blocked for 1 hour at room temperature.

mu.L of fresh phage supernatant was added to an equal volume of milk solution, and after blocking at room temperature for 1 hour, 100. mu.L of the solution was added to the ELSA plate washed with PBS, and the reaction was continued at room temperature for 1 hour.

Washing ELISA plate for 3-5 times, adding diluted M13-HRP antibody (product number 11973-MM05T-H,1:10000 dilution) at room temperature for reaction for 30min, washing ELISA plate for 5 times, adding 50 μ L of color developing solution into each well, developing for 90 sec, stopping reaction immediately, and measuring absorption value (OD) with microplate reader₄₅₀). Selecting OD₄₅₀Monoclonal with the value of more than 0.45, DNA sequencing, screening to obtain corresponding mutant scTCR _ X1-15 [ the amino acid sequences of which are respectively shown as SEQ ID NO.30+ Linker + SEQ ID NO.42, SEQ ID NO.30+ Linker + SEQ ID NO.43, SEQ ID NO.30+ Linker + SEQ ID NO.44, SEQ ID NO.30+ Linker + SEQ ID NO.45, SEQ ID NO.30+ Linker + SEQ ID NO.46, SEQ ID NO.31+ Linker + SEQ ID NO.42, SEQ ID NO.32+ Linker + SEQ ID NO.42, SEQ ID NO.33+ Linker + SEQ ID NO.42, SEQ ID NO.34+ Linker + SEQ ID NO.42, SEQ ID NO.35+ Linker + SEQ ID NO.42, SEQ ID NO.36+ Linker + SEQ ID NO.42, SEQ ID NO.37+ Linker + SEQ ID NO.42, SEQ ID NO.38+ Linker + SEQ ID NO.42, SEQ ID NO.42 and SEQ ID NO.39+ Linker + SEQ ID NO.42Q ID NO.40+ Linker + SEQ ID NO.42]. After sequence analysis, the mutations in the above mutants were found to occur in both CDR3 α and CDR3 β, the specific sites are shown in table 1 in the examples below. The Linker in this example is the same as the Linker sequence in example 2, P (GGGGS)₃。

Example 4 Gene cloning, Inclusion expression

Correspondingly introducing the mutation sites obtained in the embodiment 3 into A0 and B0 of the TCR as shown in Table 1 to obtain a variable region of A1-A11 with the amino acid sequence shown as SEQ ID NO. 19-29 and a variable region of B1-B4 with the amino acid sequence shown as SEQ ID NO. 43-46; correspondingly obtaining TCR alpha chains A1-A11 with amino acid sequences shown as SEQ ID NO. 55-65, and TCR beta chains B1-B4 with amino acid sequences shown as SEQ ID NO. 67-70 (the 'A' represents an alpha chain, the 'B' represents a beta chain, and different numbers 'A' or 'B' represent 'alpha chains' or 'beta chains' containing different mutations, in addition, in the following embodiment, a heterodimer composed of the TCR alpha chains and the TCR beta chains is simply called AmBn, wherein m is an integer of 0-11, and n is an integer of 0-4).

The mutation sites occurring in CDR3 α and CDR3 β are shown in table 1 below (wherein the bold amino acids are the mutated amino acids):

TABLE 1 mutant site display

Numbering	CDR3	SEQ ID NO.
			A1	AYDADARLM	3
A2	AFDAHARLM	4
			A3	AYDEHARLM	5
A4	AYDVHARLM	6
			A5	AYDQDARLM	7
A6	AYDENARLM	8
			A7	AYDVAARLM	9
A8	GYDQDARLM	10
			A9	SYDQEARLM	11
A10	VYDQNARLM	12
			A11	AYDQWARLM	13
B1	ASSLGANELF	14
			B2	ASSHGANELF	15
B3	ASSLGSNELF	16
			B4	ASSRGSNELF	17

The specific expression process is as follows:

TCR alpha-chain (A0-A11), beta-chain (B0-B4), scTCR, HLA-A02: 01 (or HLA-A02: 03, HLA-A02: 09, HLA-A02: 12, HLA-A02: 16) and beta 2M genes (HLA-A02: 01, beta 2M and SLWITQC are simultaneously renatured to form pMHC complex, wherein the UniProt ID of HLA-A02: 01 is P01892, HLA-A02: 03, HLA-A02: 09, HLA-A02: 12, HLA-A02: 16 is polymorphic mutant of HLA-A02: 01, the Prot ID of beta 2M is P619) are cloned from Nocol I/NcoI into VAT 28 (Nocol I) by a Nocol I/NcoI cloning method III cloning, and transformed from Nocol B467628, 9, shaking culture at 37 deg.C to OD₆₀₀When the concentration was 0.6 to 0.8, IPTG was added to the final concentration of 0.8mM, and the culture was continued at 37 ℃ for 3 hours. Centrifuging at 6000rpm for 10min, collecting thallus, and storing at-20 deg.C.

Example 5 Inclusion body purification, renaturation and purification

The cells were resuspended in a lysis buffer (0.5% TritonX 100 in PBS), sonicated, and then centrifuged at 12000rpm for 20 minutes. Discarding the supernatant, resuspending the precipitate with lysis solution until no macroscopic particles exist, centrifuging at high speed for 10 minutes, repeating the above operations for 2-3 times, dissolving the precipitate with 6M guanidine hydrochloride solution, centrifuging at high speed for 10 minutes, collecting the supernatant, wherein the supernatant is the purified inclusion body, taking 1 μ L of the supernatant to perform SDS-PAGE electrophoresis, and FIG. 6 shows that the purity of the inclusion body meets the requirement. Quantitatively packaging, and freezing at-80 deg.C.

20mg of TCR α chain and 15mg of β chain (prepared in example 4) were each diluted in 5mL of 6M guanidine hydrochloride solution. The TCR alpha chain and the TCR beta chain were slowly added to the pre-cooled renaturation buffer (Science 1996,274,209; J.mol.biol.1999,285, 1831; Protein Eng.2003,16,707) in this order, and stirred and mixed at 4 ℃ for 30 minutes. Then adding the mixture into a dialysis bag, putting the dialysis bag into 10 times volume of precooled deionized water, and stirring and dialyzing for 8-12 hours. Dialyzing against a pre-cooled dialysis solution (pH 8.1,20mM Tris-HCl) at 4 ℃ for 8 hours, and repeating 2-3 times.

The solution in the dialysis bag was decanted, centrifuged at high speed for 10 minutes to remove the precipitate and air bubbles, and subjected to anion exchange chromatography by HiTrap Q HP (5ml), and eluted linearly with 0-2M NaCl,20mM Tris pH 8.1. Collecting the elution peaks, combining and concentrating the elution peaks containing the target protein component, and displaying a band near 48kD in non-reducing SDS-PAGE electrophoresis as NY^c9-A5B0, but the purity is not satisfactory yet and further purification is required. The concentrated protein sample was subjected to molecular sieve chromatography using superdex 7510/300. A high-concentration band is detected near 48kD by non-reducing SDS-PAGE electrophoresis, and two bands are detected by reducing SDS-PAGE electrophoresis, namely an alpha-chain and a beta-chain, and the purity is about 90%. Specifically, as shown in fig. 7A and 7B, and fig. 8A and 8B (in view of the fact that the molecular weights of a0 to a11 are the same, and the molecular weights of B1 to B4 are the same, the purification results are shown here only by way of example as a5 and B0).

Example 6 preparation of biotinylated antigenic peptide-MHC (pMHC)

The renaturation and purification of pMHC were carried out as described for the NIH Tetramer Core Facility (http:// Tetramer. layers. entity. edu/support/protocols). Now, using HLA-A02: 01/SLLMWITQC as a representative example, according to the on-line protocols, a polypeptide solution and an inclusion body solution of beta 2M and HLA-A02: 01 were sequentially added to a renaturation buffer (0.1M Tris-HCl, 0.4M L-argine, 2mM EDTA; 0.5mM oxidized glutathione and 5mM reduced glutathione, 0.2mM PMSF), stirred overnight at 4 ℃, the same amount of the inclusion body solution of HLA-A02: 01 was added to the next morning and the next night, and stirred for 1 to 3 days at 4 ℃. Then dialyzed 3 times against 10 volumes of dialysate (pH 8.1,20mM Tris-HCl). And (3) performing anion exchange chromatography on the dialyzed protein sample by using HiTrap Q HP (5ml), linearly eluting by using 0-2M NaCl and 20mM Tris pH 8.1 solution, collecting an elution peak, and analyzing by SDS-PAGE electrophoresis, wherein the protein sample has two bands of pure HLA-A02: 01 and beta 2M, while the SLLMWITQC has too small molecular weight and cannot see bands on a gel picture. The eluted peaks containing pMHC fractions were pooled and concentrated for further purification by gel filtration chromatography (Superdex 7510/300) followed by SDS-PAGE electrophoresis to give the pMHC complexes of greater purity. Biotinylation was performed with a recombinase BirA (product of BPS Bioscience, product No. 70031) (Protein expr. purif.2012,82,162; j. bacteriol.2012,194,1113.) and the reaction system was prepared according to the method of NIH primer Core Facility and identified in Gel Shift purity. From Gel Shift electrophoretogram, the purity is satisfactory. The results are detailed in fig. 9A, 9B, 10A, 10B and 11.

Example 7 affinity assay

Octet is an instrument for detecting affinity by adopting SPR technology, and kinetic parameters among interacting molecules are detected according to the optical interference technology of a biological film layer based on an optical fiber biosensor, and the kinetic and affinity analysis is carried out to calculate a binding dissociation constant. In this experiment, we used the SA sensor to immobilize biotinylated pMHC, measured its binding dissociation constants to different TCRs, and calculated K_DThe value is obtained. By NY^c9A5B0 was used as a representative example to test the affinity of HLA-A02: 01/SLLMWITQC, as shown in detail in FIG. 12.

Table 2 below is for NY^c9A compilation of binding affinities of the TCR mutants and HLA-A x 02:0x/SLLMWITQC of (A-S). From the results, most of NY^c9Mutant, K binding HLA-A02: 0x/SLLMWITQC_DIs between 0.1 and 10 μ M, preferably between 0.39 and 9.3 μ M, and more preferably between 0.81 and 3.2 μ M, wherein x is 1, 3, 9, 12, and 16.

It should be noted that: as known by persons in the field, the SPR technology is one of the most common and reliable methods for measuring affinity at present, but protein quantification, chip freshness, instrument state and the like are involved, experiments in different batches have certain errors, and the error value can even reach 3-5 times; the present invention is a batch experiment performed by using the same protein quantification, the same chip and the same instrument, so that the data can be used for comparing the affinity, but the specific value does not limit the protection scope of the present invention.

Table 2 underlined are mutated amino acids

Example 8 lentivirus preparation and infection with CD8⁺T cells

(a) Wild type and mutant NY-ESO-1TCR lentiviral packaging. A third generation lentiviral packaging system (Invitrogen, pLenti6/V5 directive TOPO) was used^TMCloning Kit, product No. K495510) packaging lentiviruses containing the gene encoding the desired TCR for reduction from CD8⁺The mismatching problem of T cell TCR is referred to the related literature work in the past, and a conjugated-coil structure formed by v-Fos/v-Jun is introduced to promote pairing folding of alpha chain and beta chain of TCR (PNAS,1994,91, 11408; mol. It is also necessary to introduce the self-hydrolyzing sequence of P2A (nat. Biotech.2004,22,589; Gene ther.,2008,15, 1411; J Immunother.,2008,31, 830;) to promote the simultaneous expression and folding of the exogenously transferred α β TCR polycistrons. The C end of the TCR alpha chain is connected with v-Jun related sequences to form TCR alpha chain + v-Jun related sequences, called TRAJun for short, and the TCR beta chain + v-Fos related sequences are connected with the same way, called TRBFos for short.

v-Jun related sequence: SGSGRIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNYv-Fos related sequence: SGSGLTDTLQAETDQLEDKKSALQTEIANLLKEKEKLEFILAAYP2A related sequence: SGRAKRSGSGATNFSLLKQAGDVEENPGP

The sequences of v-Jun, v-Fos and P2A are underlined, SG and SGSG are linker sequences, and RAKR is a Furin cleavage site (J biol. chem.1999,274, 23229). For example, the full amino acid sequence of A1B0 to be expressed after insertion of the relevant sequence comprising v-Fos/v-Jun and P2A is: SEQ ID NO.19+ v-Jun related sequence + P2A related sequence + SEQ ID NO.42+ v-Fos related sequence, and the sequence of a lentiviral vector expressing A1B0 is shown in detail in FIG. 26B; after insertion of the relevant sequences comprising c-Fos/c-Jun and P2A, the lentiviral vector sequences of A0B1 required for expression were: SEQ ID NO.18+ v-Jun related sequence + P2A related sequence + SEQ ID NO.43+ v-Fos related sequence, details of the lentiviral vector expressing A0B1 are shown in FIG. 26M; the sequences of lentiviral vectors expressing A0B0, A1B0, A2B0, A3B0, A4B0, A5B0, A6B0, A7B0, A8B0, A9B0, A10B0, A11B0, A0B1, A0B2, A0B3 and A0B4, respectively, are detailed in FIGS. 26A-26P.

Specifically, the packaging wild-type and mutant pLenti6-NY-ESO-1TRAJun-2A-TRBFos and pLenti6-eGFP pseudoviruses were mixed with packaging plasmids pMDLg/pRRE (addge, product No. k12251), pRSV-REV (addge, product No. 12253) and pMD2.G (addge, product No. 12259) at a ratio of 3:2:2:1 (see product Manual for details), and 293T cells (purchased from ATCC, product No. CRL-3216) in logarithmic growth phase were transiently transfected. The transfection reagent PEI-MAX (from Polyscience, product No. 23966-1) and the plasmid were used in a ratio of 2:1 (volume to mass ratio), and the specific procedures were performed according to the instructions.

Culture supernatants containing packaged lentiviruses were collected on days 3 and 4 and concentrated. The collected culture supernatant was concentrated to a final volume of 1ml using a 50kD molecular weight cut-off concentration tube (Merck Millipore), and frozen at-80 ℃. Pseudovirus samples were taken for virus titer determination, procedures were referenced to p24ELISA (Clontech, product No. 632200) kit instructions. As a control, a pseudovirus transfected with pLenti6-eGFP was also included.

(b) Transduction of primary CD8 with lentiviruses containing NY-ESO-1 specific T cell receptor genes⁺T cells

CD8⁺T cell isolation and stimulation amplification, reagents were used as per reference (J Immunol methods.2006,310, 40; J trans.med.2010, 8,104; Nat protoc.2014,9,950). Enrichment of CD8 from blood of healthy volunteers by negative isolation⁺T cells (antibody-coupled magnetic beads available from Miltenyi Biotec), methods of use of antibody-magnetic beads following the product instructions, CD8⁺The separation effect of the T cells can reach more than 90 percent. CD8 was cultured in RPMI-1640 complete medium (10% FBS) containing 50IU/mL IL-2(Peprotech, product number AF-200-02) and 10ng/mL IL-7(Peprotech, product number AF-200-07)⁺T cells were co-incubated with prewashed anti-CD 3/CD28 antibody-coated beads (Life Technologies, product No. 11452D) overnight for stimulation, cells: beads ═ 1: 1.

According to the virus titer, concentrated lentivirus was added at an MOI of 10, and centrifuged at 900g at 32 ℃ for 1 hour. Removal of lentivirus infection fluid, reference and work related thereto (J Immunol Methods,1990,128,189), resuspension of cells in RPMI-1640 complete medium containing 50IU/mL IL-2 and 10ng/mL IL-7, 37 ℃/5% CO₂Culturing under the condition. Cell infection efficiency was analyzed by flow cytometry at day 3 of transduction, and was used for functional assays (e.g., ELISPOT for IFN- γ release and non-radioactive cytotoxicity assays) starting at day 5 of transduction.

Flow cytometry analysis of CD8⁺The transduction efficiency of the TCR in T cells (TCR labeled by PE and CD8 labeled by APC) is shown in detail in FIG. 13, with particular reference to the protocol of the paper (Blood,2010,115,3718).

Example 9 validation of NY-ESO-1 specific TCR Functions-detection of T by the ELISPOT protocol₂Cellular polypeptide-loaded INF-gamma release

The protocol uses IFN-. gamma.production as a marker for T cell activation, and measures TCR-transduced T cells in response to specific activation of target cells, as performed in the protocol reference (PNAS,2011,108,2991).

The target cell of this assay is T₂Cells, Effector cells are CD8 analyzed by flow cytometry in example 8 and expressing the NY-ESO-1TCR⁺T cells and CD8 of the same volunteer⁺T cells served as negative control effector cells. Will be provided withCD8⁺The T cells were resuspended in the test medium (RPMI 1640 in 10% FBS) at 2 × the desired final concentration.

PVDF ELISPOT 96-well plates (Merck Millipore, product No. MSIPS4510) were prepared according to the manufacturer's instructions by diluting anti-human IFN-. gamma.capture antibody (human IFN-. gamma.ELISPOT PVDF-enzyme kit, BD Co., product No. 551849) with sterile PBS in a ratio of 1:200 and incubating overnight at 4 ℃. After washing to remove excess capture antibody, the well plates were blocked with 10% FBS in PBS for 2 hours at room temperature.

The components of the assay were then added to ELISPOT well plates in sequence: 1.10000T₂Cells/well; 2.1000 NY-ESO-1TCR CD8⁺Double positive T cells, or negative control CD8⁺A T cell; 3.20 microliter SLLMWITQC short peptide (positive polypeptide) with concentration of 10. mu.M, three non-specific short peptide solutions VLDGLDVLL (negative polypeptide 1), GLYDGMEHL (negative polypeptide 2), TIHDIILECV (negative polypeptide 3), and final concentration of 1. mu.M. All experimental groups were in triplicate.

Plates were incubated overnight (37 ℃/5% CO)₂) Following the protocol of the human IFN-. gamma.ELISPOT PVDF-enzyme kit, the medium was discarded, washed with double distilled water and washing buffer (0.01M PBS/0.05% Tween20), the assay primary antibody was diluted with 10% FBS PBS, the plates were incubated at room temperature for 2 hours, washed, diluted with 10% FBS PBS, and incubated at room temperature for 1 hour. After washing 3 times with washing buffer and 2 times with PBS, 100. mu.l/well of BCIP/NBT solution provided by the kit was added for development for 5-15 minutes. The BCIP/NBT solution was removed and the well plate was rinsed with double steam to stop the development reaction, and the well plate was dried at room temperature until each well was completely dried. The results are shown in FIG. 14, NY^c9A2B0, A3B0 and A5B0 were only at T₂After the cells are loaded with SLLMWITQC positive polypeptide, INF-gamma release signals exist, but no obvious INF-gamma release signals are just detected when the cells are not loaded with polypeptide, VLDGLDVLL (negative polypeptide 1), GLYDGMEHL (negative polypeptide 2) and TIHDIILECV (negative polypeptide 3), which indicates NY^c9A2B0, A3B0 and A5B0 specifically recognized HLA-A02: 01/SLLMWITQC.

Example 10 validation of NY-ESO-1 specific TCR function-LDH-specific killing of tumor cell lines

This test was 51^CrColorimetric alternative assay to release cytotoxicity assay, quantitative determination of Lactate Dehydrogenase (LDH) released after cell lysis, protocol reference (eur. j immunol.1993,23,3217). LDH released in the medium was detected using a 30min coupled enzymatic reaction in which LDH converted a tetrazolium salt (INT) to red formazan (formazan). The amount of red product produced is proportional to the number of cells lysed. 490nm visible absorbance data can be collected using a standard 96-well plate reader. The test uses four cell lines of A375, U266, 293T and NCI-H1299 as target cells, and inoculates 1.5X 10 cells per well⁴And (4) cells. Effector cells (T cells) CD8 expressing NY-ESO-1 specific TCR in example 8 analyzed by flow cytometry⁺T cells. The ratio of effector cells to target cells was 10:1/5:1/2.5:1/1.25:1/0.625: 1. Set up the source CD8⁺T cells plus target cells were used as a control (5: 1).

The components of the assay were added to a microwell round bottom 96 well tissue culture plate in sequence: 1.100. mu.L of target cells (prepared as described above, 1.5X 10)⁴Individual target cells/well); 2.100 μ L of effector cells (prepared as described above). Adding a control group: 1. effector cell spontaneous release: there were only 100. mu.L of effector cells. 2. Target cells release spontaneously: there were only 100. mu.L of target cells. 3. Maximum release of target cells-only 100. mu.L of target cells (additional lysate was added for the experiment). 4. Control of the medium: there was only 200. mu.L of medium. 5. Volume correction hole: there was only 200. mu.L of medium. All experimental groups were in triplicate and the final volume was 200. mu.L (insufficient media make-up).

CytoTox was used for the experimentNon-radioactive cytotoxicity assay kit (Promega, G1780, containing substrate mixture, assay buffer, lysis solution and stop buffer). Before collecting the supernatants from all wells, 20. mu.L of lysis solution was added to the maximum release control wells and volume corrected wells and left at 37 ℃ for 30 minutes to allow complete lysis of the target cells.

After incubation of the mixed cells at 37 ℃ for 24 hours, the plate was centrifuged at 250g for 4 minutes, and 50. mu.L of the supernatant from each well of the assay plate was transferred to the corresponding well of a 96-well immunoplate Maxisorb plate. Add 50. mu.L of substrate mixture to each well and incubate for 30min at room temperature in the dark. 50 μ L of stop solution was added to each well of the plate to stop the reaction. Absorbance at 490nm was read within 1 hour after addition of the stop solution.

And (3) calculating the result: the absorbance of the medium background was subtracted from all absorbance values of the experimental, target cell spontaneous release and effector cell spontaneous release groups. The corrected values obtained above were substituted into the following formula, and the percent cytotoxicity generated for each effect-to-target ratio was calculated. Cytotoxicity (%) ═ 100 × (experiment-effector cell spontaneous-target cell spontaneous)/(target cell maximal-target cell spontaneous).

The results showed that CD8 expressing TCR mutants A3B0 and A5B0⁺The T cell selectively kills human melanoma cells A375 and human myeloid malignant leukemia cells U266B1 and IM9 which are double positive for HLA-A02: 01 and NY-ESO-1, but has no specific killing effect on single positive human kidney epithelial cells 293T and human lung cancer cells NCI-H1299, and is similar to the negative control GFP T cell.

Based on the above experiments, LDH killing experiments for A3B0 and A5B0 were optimized (other conditions were not changed, E: T was optimized to be 2.5:1), and positive cell lines of IM9 were introduced, and the results of the experiments are shown in FIG. 15. According to the results of LDH, the specific killing activity of A3B0 and A5B0 on tumor cells is comparable to that of a positive control 1G 4; specifically, the killing effect of A3B0 and A5B0 on A375 and IM9 is about 10% higher than that of the positive control 1G4, especially the killing effect of A5B0 on A375 and IM 9.

Example 11 validation of NY-ESO-1 specific TCR function-A375 melanoma xenograft experiments

NOD/SCID mice, female, 4 weeks old were used for the experiments. After the animals were purchased, they were housed in an SPF grade animal breeding center, 5 animals per cage. The temperature in the animal raising room is kept at 20 +/-2 ℃, air is changed for 15 times per hour, the illumination time per day is divided equally (12 hours of light: 12 hours of darkness), and the relative humidity is kept at 50% -55%. Hard wood chips are arranged in the mouse cage, and each group of mice uniformly feeds standard feed and clean drinking purified water. The mice in each group were acclimatized for 1 week before subsequent experiments.

The mice were randomly divided into a negative control group (GFP-T cells), a positive control group (1G4 TCR-T cells; wherein 1G4 is an alpha 95-LY mutant mentioned in J.Immunol.2008,180,6116. the sequence of which is synthesized by Biocompany), and experimental groups (A3B 0TCR-T cells and A5B0TCR-T cells), and each group had 5 mice, and 20 mice in total were cut and labeled with incisions. The experiment adopts a mode of subcutaneous inoculation of cells to establish a tumor animal model, specifically, the back of the right hind limb of each mouse is shaved and inoculated with 5 multiplied by 10⁶A375 cells (human melanoma cells) and 1.5X 10⁷T cell mixture (cells collected in PBS buffer), each mouse inoculated with total cell volume of 200 u L, after inoculation of cells, each mouse intraperitoneal injection of human recombinant IL-2100 u L (stock solution concentration 50 ten thousand units/mL), continuous injection for 5 days. Ten days after inoculation, the tumor volume is measured, every two days thereafter, the tumor length and length are recorded, the volume is calculated, and a tumor growth curve is drawn. The formula for calculating the tumor volume is V-1/6 × π × a × b²(a is the major axis, b is the minor axis). CO after one month₂Mice were euthanized.

The tumor growth of each group of mice is shown in FIG. 16. Compared with the negative control group of GFP-T cells, 1G4 TCR-T cells, A3B 0TCR-T cells and A5B0TCR-T cells can effectively kill tumor cells A375, inhibit the growth of tumors, and have no obvious change in the tumor growth curve along with time, as shown in FIG. 17 (in the following example, A5B0 is taken as an example for follow-up experiments in view of the fact that A3B 0TCR-T cells have equivalent effects to A5B0TCR-T cells).

Example 12 validation of NY-ESO-1 specific TCR function-healthy human PBMC specific INF-Gamma Release

For investigating NY^C9Safety of high affinity mutants 40 healthy human PBMCs were investigated for safety using the INF-gamma release assay used in example 9. PBMCs of 10 healthy persons contained HLA-a02: 01 typing, PBMCs of 30 healthy persons did not contain HLA-a02: 01 typing. As a result of the Release reaction from INF-gamma, NY^c9A5B0TCR-T cells did not significantly react with PBMC from 40 healthy persons, regardless of whether HLA typing of 10 PBMC was A02:01 (NY)^c9A5B0 HLA-containing samples from 10 healthy personsA02:01 INF-gamma release data of typing PBMC, the reaction intensity of which is equivalent to that of negative and positive controls; see FIG. 18 for details), also non-HLA-A02: 01 typing (NY) of 30 PBMCs^c9The intensity of the response of A5B0 to INF-gamma release data from 30 non-HLA-A02: 01 typed PBMC from healthy humans was comparable to that of the negative and positive controls; see fig. 19 for details).

Example 13 validation of NY-ESO-1 specific TCR function-healthy human Primary cell specific INF-Gamma Release

For investigating NY^C9Safety of high affinity mutants primary cells from 5 major organs were investigated using the INF-gamma release assay used in example 9. Wherein CCC-HEK-1, MRC-5, CCC-HEH-2, CCC-HEL-1 and CCC-HPF-1 are primary cells from embryos, purchased from a national laboratory cell resource sharing platform, and MRC-5 is from ATCC. As a result of the Release reaction from INF-gamma, NY^c9The response intensity of A5B0TCR-T cells was comparable to that of the negative and positive controls, and did not significantly react with primary cells of these vital organs (see FIG. 20 for details).

Example 14 validation of NY-ESO-1 specific TCR function-multiple HLA-A02:0 Xtyping functional validation

For investigating NY^C9Compatibility of high affinity mutants with multiple HLA-A02:0x typing, infecting the HLA-A02 negative, NY-ESO-1 positive NCI-H1299 tumor cell line with lentiviruses carrying the HLA-A02:0x gene. Then, NC-H1299 infected with various HLA-A02:0X was subjected to INF- γ release test using INF- γ release test used in example 9 to evaluate NY^c9Activity of A5B0 high affinity mutants on multiple HLA-a x 02:0x typing. FIG. 21 shows NY^c9A5B0 has obvious activity on HLA-A02: 03, better activity on HLA-A02: 12, and equivalent activity on HLA-A02: 01, HLA-A02: 09 and HLA-A02: 16.

Example 15NY-ESO-1 specific TCR function multiple HLA-A02:0x typing safety validation

For investigating NY^c9The A5B0 high affinity mutant HAs high safety to multiple HLA-A02:0x typing, and can be used for infecting various human primary cells, such as Human Astrocytes (HA), Human Lung Fibroblasts (HLF), and human embryo liver thin cell, with lentivirus of HLA-A02:0x geneCells (CCC-HEL) and human embryonic lung cells (CCC-HPF), and then human primary cells infected with different HLA-A02:0x were subjected to INF- γ release assay using INF- γ release assay used in example 9 to evaluate NY^c9Safety of A5B0 high affinity mutants against multiple HLA-a x 02:0x typing. FIG. 22, FIG. 23, FIG. 24 and FIG. 25 show NY, respectively^c9The results of INF-gamma release experiments of A5B0 on Human Astrocytes (HA), Human Lung Fibroblasts (HLF), human embryonic hepatocytes (CCC-HEL) and human embryonic hepatocytes (CCC-HPF) infected with various HLA-A02:0x patterns showed NY^c9A5B0 was safe for identification of multiple HLA-a x 02:0x typing.

SEQUENCE LISTING

<110> Shenzhen ai Tak Biotech Limited

<120> a TCR and uses thereof

<130> P19012717C

<160> 74

<170> PatentIn version 3.5

<210> 1

<211> 9

<212> PRT

<213> Homo sapiens

<400> 1

Ala Ser Asp Gln Asp Ala Arg Leu Met

1 5

<210> 2

<211> 9

<212> PRT

<213> Artificial Sequence

<220>

<223> A1 CDR3

<400> 2

Ala Tyr Asp Ala Asp Ala Arg Leu Met

1 5

<210> 3

<211> 9

<212> PRT

<213> Artificial Sequence

<220>

<223> A2 CDR3

<400> 3

Ala Phe Asp Ala His Ala Arg Leu Met

1 5

<210> 4

<211> 9

<212> PRT

<213> Artificial Sequence

<220>

<223> A3 CDR3

<400> 4

Ala Tyr Asp Glu His Ala Arg Leu Met

1 5

<210> 5

<211> 9

<212> PRT

<213> Artificial Sequence

<220>

<223> A4 CDR3

<400> 5

Ala Tyr Asp Val His Ala Arg Leu Met

1 5

<210> 6

<211> 9

<212> PRT

<213> Artificial Sequence

<220>

<223> A5 CDR3

<400> 6

Ala Tyr Asp Gln Asp Ala Arg Leu Met

1 5

<210> 7

<211> 9

<212> PRT

<213> Artificial Sequence

<220>

<223> A6 CDR3

<400> 7

Ala Tyr Asp Glu Asn Ala Arg Leu Met

1 5

<210> 8

<211> 9

<212> PRT

<213> Artificial Sequence

<220>

<223> A7 CDR3

<400> 8

Ala Tyr Asp Val Ala Ala Arg Leu Met

1 5

<210> 9

<211> 9

<212> PRT

<213> Artificial Sequence

<220>

<223> A8 CDR3

<400> 9

Gly Tyr Asp Gln Asp Ala Arg Leu Met

1 5

<210> 10

<211> 9

<212> PRT

<213> Artificial Sequence

<220>

<223> A9 CDR3

<400> 10

Ser Tyr Asp Gln Glu Ala Arg Leu Met

1 5

<210> 11

<211> 9

<212> PRT

<213> Artificial Sequence

<220>

<223> A10 CDR3

<400> 11

Val Tyr Asp Gln Asn Ala Arg Leu Met

1 5

<210> 12

<211> 9

<212> PRT

<213> Artificial Sequence

<220>

<223> A11 CDR3

<400> 12

Ala Tyr Asp Gln Trp Ala Arg Leu Met

1 5

<210> 13

<211> 10

<212> PRT

<213> Homo sapiens

<400> 13

Ala Ser Ser Leu Gly Pro Gly Glu Leu Phe

1 5 10

<210> 14

<211> 10

<212> PRT

<213> Artificial Sequence

<220>

<223> B1 CDR3

<400> 14

Ala Ser Ser Leu Gly Ala Asn Glu Leu Phe

1 5 10

<210> 15

<211> 10

<212> PRT

<213> Artificial Sequence

<220>

<223> B2 CDR3

<400> 15

Ala Ser Ser His Gly Ala Asn Glu Leu Phe

1 5 10

<210> 16

<211> 10

<212> PRT

<213> Artificial Sequence

<220>

<223> B3 CDR3

<400> 16

Ala Ser Ser Leu Gly Ser Asn Glu Leu Phe

1 5 10

<210> 17

<211> 10

<212> PRT

<213> Artificial Sequence

<220>

<223> B4 CDR3

<400> 17

Ala Ser Ser Arg Gly Ser Asn Glu Leu Phe

1 5 10

<210> 18

<211> 109

<212> PRT

<213> Homo sapiens

<400> 18

Met Ser Gln Gln Gly Glu Glu Asp Pro Gln Ala Leu Ser Ile Gln Glu

1 5 10 15

Gly Glu Asn Ala Thr Met Asn Cys Ser Tyr Lys Thr Ser Ile Asn Asn

20 25 30

Leu Gln Trp Tyr Arg Gln Asn Ser Gly Arg Gly Leu Val His Leu Ile

35 40 45

Leu Ile Arg Ser Asn Glu Arg Glu Lys His Ser Gly Arg Leu Arg Val

50 55 60

Thr Leu Asp Thr Ser Lys Lys Ser Ser Ser Leu Leu Ile Thr Ala Ser

65 70 75 80

Arg Ala Ala Asp Thr Ala Ser Tyr Phe Cys Ala Ser Asp Gln Asp Ala

85 90 95

Arg Leu Met Phe Gly Asp Gly Thr Gln Leu Val Val Lys

100 105

<210> 19

<211> 109

<212> PRT

<213> Artificial Sequence

<220>

<223> variable region of A1

<400> 19

Met Ser Gln Gln Gly Glu Glu Asp Pro Gln Ala Leu Ser Ile Gln Glu

1 5 10 15

Gly Glu Asn Ala Thr Met Asn Cys Ser Tyr Lys Thr Ser Ile Asn Asn

20 25 30

Leu Gln Trp Tyr Arg Gln Asn Ser Gly Arg Gly Leu Val His Leu Ile

35 40 45

Leu Ile Arg Ser Asn Glu Arg Glu Lys His Ser Gly Arg Leu Arg Val

50 55 60

Thr Leu Asp Thr Ser Lys Lys Ser Ser Ser Leu Leu Ile Thr Ala Ser

65 70 75 80

Arg Ala Ala Asp Thr Ala Ser Tyr Phe Cys Ala Tyr Asp Ala Asp Ala

85 90 95

Arg Leu Met Phe Gly Asp Gly Thr Gln Leu Val Val Lys

100 105

<210> 20

<211> 109

<212> PRT

<213> Artificial Sequence

<220>

<223> variable region of A2

<400> 20

Met Ser Gln Gln Gly Glu Glu Asp Pro Gln Ala Leu Ser Ile Gln Glu

1 5 10 15

Gly Glu Asn Ala Thr Met Asn Cys Ser Tyr Lys Thr Ser Ile Asn Asn

20 25 30

Leu Gln Trp Tyr Arg Gln Asn Ser Gly Arg Gly Leu Val His Leu Ile

35 40 45

Leu Ile Arg Ser Asn Glu Arg Glu Lys His Ser Gly Arg Leu Arg Val

50 55 60

Thr Leu Asp Thr Ser Lys Lys Ser Ser Ser Leu Leu Ile Thr Ala Ser

65 70 75 80

Arg Ala Ala Asp Thr Ala Ser Tyr Phe Cys Ala Phe Asp Ala His Ala

85 90 95

Arg Leu Met Phe Gly Asp Gly Thr Gln Leu Val Val Lys

100 105

<210> 21

<211> 109

<212> PRT

<213> Artificial Sequence

<220>

<223> variable region of A3

<400> 21

Met Ser Gln Gln Gly Glu Glu Asp Pro Gln Ala Leu Ser Ile Gln Glu

1 5 10 15

Gly Glu Asn Ala Thr Met Asn Cys Ser Tyr Lys Thr Ser Ile Asn Asn

20 25 30

Leu Gln Trp Tyr Arg Gln Asn Ser Gly Arg Gly Leu Val His Leu Ile

35 40 45

Leu Ile Arg Ser Asn Glu Arg Glu Lys His Ser Gly Arg Leu Arg Val

50 55 60

Thr Leu Asp Thr Ser Lys Lys Ser Ser Ser Leu Leu Ile Thr Ala Ser

65 70 75 80

Arg Ala Ala Asp Thr Ala Ser Tyr Phe Cys Ala Tyr Asp Glu His Ala

85 90 95

Arg Leu Met Phe Gly Asp Gly Thr Gln Leu Val Val Lys

100 105

<210> 22

<211> 109

<212> PRT

<213> Artificial Sequence

<220>

<223> variable region of A4

<400> 22

Met Ser Gln Gln Gly Glu Glu Asp Pro Gln Ala Leu Ser Ile Gln Glu

1 5 10 15

Gly Glu Asn Ala Thr Met Asn Cys Ser Tyr Lys Thr Ser Ile Asn Asn

20 25 30

Leu Gln Trp Tyr Arg Gln Asn Ser Gly Arg Gly Leu Val His Leu Ile

35 40 45

Leu Ile Arg Ser Asn Glu Arg Glu Lys His Ser Gly Arg Leu Arg Val

50 55 60

Thr Leu Asp Thr Ser Lys Lys Ser Ser Ser Leu Leu Ile Thr Ala Ser

65 70 75 80

Arg Ala Ala Asp Thr Ala Ser Tyr Phe Cys Ala Tyr Asp Val His Ala

85 90 95

Arg Leu Met Phe Gly Asp Gly Thr Gln Leu Val Val Lys

100 105

<210> 23

<211> 109

<212> PRT

<213> Artificial Sequence

<220>

<223> variable region of A5

<400> 23

Met Ser Gln Gln Gly Glu Glu Asp Pro Gln Ala Leu Ser Ile Gln Glu

1 5 10 15

Gly Glu Asn Ala Thr Met Asn Cys Ser Tyr Lys Thr Ser Ile Asn Asn

20 25 30

Leu Gln Trp Tyr Arg Gln Asn Ser Gly Arg Gly Leu Val His Leu Ile

35 40 45

Leu Ile Arg Ser Asn Glu Arg Glu Lys His Ser Gly Arg Leu Arg Val

50 55 60

Thr Leu Asp Thr Ser Lys Lys Ser Ser Ser Leu Leu Ile Thr Ala Ser

65 70 75 80

Arg Ala Ala Asp Thr Ala Ser Tyr Phe Cys Ala Tyr Asp Gln Asp Ala

85 90 95

Arg Leu Met Phe Gly Asp Gly Thr Gln Leu Val Val Lys

100 105

<210> 24

<211> 109

<212> PRT

<213> Artificial Sequence

<220>

<223> variable region of A6

<400> 24

Met Ser Gln Gln Gly Glu Glu Asp Pro Gln Ala Leu Ser Ile Gln Glu

1 5 10 15

Gly Glu Asn Ala Thr Met Asn Cys Ser Tyr Lys Thr Ser Ile Asn Asn

20 25 30

Leu Gln Trp Tyr Arg Gln Asn Ser Gly Arg Gly Leu Val His Leu Ile

35 40 45

Leu Ile Arg Ser Asn Glu Arg Glu Lys His Ser Gly Arg Leu Arg Val

50 55 60

Thr Leu Asp Thr Ser Lys Lys Ser Ser Ser Leu Leu Ile Thr Ala Ser

65 70 75 80

Arg Ala Ala Asp Thr Ala Ser Tyr Phe Cys Ala Tyr Asp Glu Asn Ala

85 90 95

Arg Leu Met Phe Gly Asp Gly Thr Gln Leu Val Val Lys

100 105

<210> 25

<211> 109

<212> PRT

<213> Artificial Sequence

<220>

<223> variable region of A7

<400> 25

Met Ser Gln Gln Gly Glu Glu Asp Pro Gln Ala Leu Ser Ile Gln Glu

1 5 10 15

Gly Glu Asn Ala Thr Met Asn Cys Ser Tyr Lys Thr Ser Ile Asn Asn

20 25 30

Leu Gln Trp Tyr Arg Gln Asn Ser Gly Arg Gly Leu Val His Leu Ile

35 40 45

Leu Ile Arg Ser Asn Glu Arg Glu Lys His Ser Gly Arg Leu Arg Val

50 55 60

Thr Leu Asp Thr Ser Lys Lys Ser Ser Ser Leu Leu Ile Thr Ala Ser

65 70 75 80

Arg Ala Ala Asp Thr Ala Ser Tyr Phe Cys Ala Tyr Asp Val Ala Ala

85 90 95

Arg Leu Met Phe Gly Asp Gly Thr Gln Leu Val Val Lys

100 105

<210> 26

<211> 109

<212> PRT

<213> Artificial Sequence

<220>

<223> variable region of A8

<400> 26

Met Ser Gln Gln Gly Glu Glu Asp Pro Gln Ala Leu Ser Ile Gln Glu

1 5 10 15

Gly Glu Asn Ala Thr Met Asn Cys Ser Tyr Lys Thr Ser Ile Asn Asn

20 25 30

Leu Gln Trp Tyr Arg Gln Asn Ser Gly Arg Gly Leu Val His Leu Ile

35 40 45

Leu Ile Arg Ser Asn Glu Arg Glu Lys His Ser Gly Arg Leu Arg Val

50 55 60

Thr Leu Asp Thr Ser Lys Lys Ser Ser Ser Leu Leu Ile Thr Ala Ser

65 70 75 80

Arg Ala Ala Asp Thr Ala Ser Tyr Phe Cys Gly Tyr Asp Gln Asp Ala

85 90 95

Arg Leu Met Phe Gly Asp Gly Thr Gln Leu Val Val Lys

100 105

<210> 27

<211> 109

<212> PRT

<213> Artificial Sequence

<220>

<223> variable region of A9

<400> 27

Met Ser Gln Gln Gly Glu Glu Asp Pro Gln Ala Leu Ser Ile Gln Glu

1 5 10 15

Gly Glu Asn Ala Thr Met Asn Cys Ser Tyr Lys Thr Ser Ile Asn Asn

20 25 30

Leu Gln Trp Tyr Arg Gln Asn Ser Gly Arg Gly Leu Val His Leu Ile

35 40 45

Leu Ile Arg Ser Asn Glu Arg Glu Lys His Ser Gly Arg Leu Arg Val

50 55 60

Thr Leu Asp Thr Ser Lys Lys Ser Ser Ser Leu Leu Ile Thr Ala Ser

65 70 75 80

Arg Ala Ala Asp Thr Ala Ser Tyr Phe Cys Ser Tyr Asp Gln Glu Ala

85 90 95

Arg Leu Met Phe Gly Asp Gly Thr Gln Leu Val Val Lys

100 105

<210> 28

<211> 109

<212> PRT

<213> Artificial Sequence

<220>

<223> variable region of A10

<400> 28

Met Ser Gln Gln Gly Glu Glu Asp Pro Gln Ala Leu Ser Ile Gln Glu

1 5 10 15

Gly Glu Asn Ala Thr Met Asn Cys Ser Tyr Lys Thr Ser Ile Asn Asn

20 25 30

Leu Gln Trp Tyr Arg Gln Asn Ser Gly Arg Gly Leu Val His Leu Ile

35 40 45

Leu Ile Arg Ser Asn Glu Arg Glu Lys His Ser Gly Arg Leu Arg Val

50 55 60

Thr Leu Asp Thr Ser Lys Lys Ser Ser Ser Leu Leu Ile Thr Ala Ser

65 70 75 80

Arg Ala Ala Asp Thr Ala Ser Tyr Phe Cys Val Tyr Asp Gln Asn Ala

85 90 95

Arg Leu Met Phe Gly Asp Gly Thr Gln Leu Val Val Lys

100 105

<210> 29

<211> 109

<212> PRT

<213> Artificial Sequence

<220>

<223> variable region of A11

<400> 29

Met Ser Gln Gln Gly Glu Glu Asp Pro Gln Ala Leu Ser Ile Gln Glu

1 5 10 15

Gly Glu Asn Ala Thr Met Asn Cys Ser Tyr Lys Thr Ser Ile Asn Asn

20 25 30

Leu Gln Trp Tyr Arg Gln Asn Ser Gly Arg Gly Leu Val His Leu Ile

35 40 45

Leu Ile Arg Ser Asn Glu Arg Glu Lys His Ser Gly Arg Leu Arg Val

50 55 60

Thr Leu Asp Thr Ser Lys Lys Ser Ser Ser Leu Leu Ile Thr Ala Ser

65 70 75 80

Arg Ala Ala Asp Thr Ala Ser Tyr Phe Cys Ala Tyr Asp Gln Trp Ala

85 90 95

Arg Leu Met Phe Gly Asp Gly Thr Gln Leu Val Val Lys

100 105

<210> 30

<211> 109

<212> PRT

<213> Artificial Sequence

<220>

<223> variable region after mutation of A0 framework

<400> 30

Met Ser Gln Gln Gly Glu Glu Asp Pro Gln Ala Leu Ser Ile Gln Glu

1 5 10 15

Gly Glu Asn Ala Thr Ile Asn Cys Ser Tyr Lys Thr Ser Ile Asn Asn

20 25 30

Leu Gln Trp Tyr Arg Gln Asp Pro Gly Arg Gly Leu Val His Leu Ile

35 40 45

Leu Ile Arg Ser Asn Glu Arg Glu Lys His Ser Gly Arg Leu Arg Val

50 55 60

Thr Leu Asp Thr Ser Lys Lys Ser Ser Ser Leu Glu Ile Thr Ala Thr

65 70 75 80

Arg Pro Ala Asp Thr Ala Ser Tyr Phe Cys Ala Ser Asp Gln Asp Ala

85 90 95

Arg Leu Met Phe Gly Asp Gly Thr Gln Leu Thr Val Asn

100 105

<210> 31

<211> 109

<212> PRT

<213> Artificial Sequence

<220>

<223> variable region after mutation of A1 framework

<400> 31

Met Ser Gln Gln Gly Glu Glu Asp Pro Gln Ala Leu Ser Ile Gln Glu

1 5 10 15

Gly Glu Asn Ala Thr Ile Asn Cys Ser Tyr Lys Thr Ser Ile Asn Asn

20 25 30

Leu Gln Trp Tyr Arg Gln Asp Pro Gly Arg Gly Leu Val His Leu Ile

35 40 45

Leu Ile Arg Ser Asn Glu Arg Glu Lys His Ser Gly Arg Leu Arg Val

50 55 60

Thr Leu Asp Thr Ser Lys Lys Ser Ser Ser Leu Glu Ile Thr Ala Thr

65 70 75 80

Arg Pro Ala Asp Thr Ala Ser Tyr Phe Cys Ala Tyr Asp Ala Asp Ala

85 90 95

Arg Leu Met Phe Gly Asp Gly Thr Gln Leu Thr Val Asn

100 105

<210> 32

<211> 109

<212> PRT

<213> Artificial Sequence

<220>

<223> variable region after mutation of A2 framework

<400> 32

Met Ser Gln Gln Gly Glu Glu Asp Pro Gln Ala Leu Ser Ile Gln Glu

1 5 10 15

Gly Glu Asn Ala Thr Ile Asn Cys Ser Tyr Lys Thr Ser Ile Asn Asn

20 25 30

Leu Gln Trp Tyr Arg Gln Asp Pro Gly Arg Gly Leu Val His Leu Ile

35 40 45

Leu Ile Arg Ser Asn Glu Arg Glu Lys His Ser Gly Arg Leu Arg Val

50 55 60

Thr Leu Asp Thr Ser Lys Lys Ser Ser Ser Leu Glu Ile Thr Ala Thr

65 70 75 80

Arg Pro Ala Asp Thr Ala Ser Tyr Phe Cys Ala Phe Asp Ala His Ala

85 90 95

Arg Leu Met Phe Gly Asp Gly Thr Gln Leu Thr Val Asn

100 105

<210> 33

<211> 109

<212> PRT

<213> Artificial Sequence

<220>

<223> variable region after mutation of A3 framework

<400> 33

Met Ser Gln Gln Gly Glu Glu Asp Pro Gln Ala Leu Ser Ile Gln Glu

1 5 10 15

Gly Glu Asn Ala Thr Ile Asn Cys Ser Tyr Lys Thr Ser Ile Asn Asn

20 25 30

Leu Gln Trp Tyr Arg Gln Asp Pro Gly Arg Gly Leu Val His Leu Ile

35 40 45

Leu Ile Arg Ser Asn Glu Arg Glu Lys His Ser Gly Arg Leu Arg Val

50 55 60

Thr Leu Asp Thr Ser Lys Lys Ser Ser Ser Leu Glu Ile Thr Ala Thr

65 70 75 80

Arg Pro Ala Asp Thr Ala Ser Tyr Phe Cys Ala Tyr Asp Glu His Ala

85 90 95

Arg Leu Met Phe Gly Asp Gly Thr Gln Leu Thr Val Asn

100 105

<210> 34

<211> 109

<212> PRT

<213> Artificial Sequence

<220>

<223> variable region after mutation of A4 framework

<400> 34

Met Ser Gln Gln Gly Glu Glu Asp Pro Gln Ala Leu Ser Ile Gln Glu

1 5 10 15

Gly Glu Asn Ala Thr Ile Asn Cys Ser Tyr Lys Thr Ser Ile Asn Asn

20 25 30

Leu Gln Trp Tyr Arg Gln Asp Pro Gly Arg Gly Leu Val His Leu Ile

35 40 45

Leu Ile Arg Ser Asn Glu Arg Glu Lys His Ser Gly Arg Leu Arg Val

50 55 60

Thr Leu Asp Thr Ser Lys Lys Ser Ser Ser Leu Glu Ile Thr Ala Thr

65 70 75 80

Arg Pro Ala Asp Thr Ala Ser Tyr Phe Cys Ala Tyr Asp Val His Ala

85 90 95

Arg Leu Met Phe Gly Asp Gly Thr Gln Leu Thr Val Asn

100 105

<210> 35

<211> 109

<212> PRT

<213> Artificial Sequence

<220>

<223> variable region after mutation of A5 framework

<400> 35

Met Ser Gln Gln Gly Glu Glu Asp Pro Gln Ala Leu Ser Ile Gln Glu

1 5 10 15

Gly Glu Asn Ala Thr Ile Asn Cys Ser Tyr Lys Thr Ser Ile Asn Asn

20 25 30

Leu Gln Trp Tyr Arg Gln Asp Pro Gly Arg Gly Leu Val His Leu Ile

35 40 45

Leu Ile Arg Ser Asn Glu Arg Glu Lys His Ser Gly Arg Leu Arg Val

50 55 60

Thr Leu Asp Thr Ser Lys Lys Ser Ser Ser Leu Glu Ile Thr Ala Thr

65 70 75 80

Arg Pro Ala Asp Thr Ala Ser Tyr Phe Cys Ala Tyr Asp Gln Asp Ala

85 90 95

Arg Leu Met Phe Gly Asp Gly Thr Gln Leu Thr Val Asn

100 105

<210> 36

<211> 109

<212> PRT

<213> Artificial Sequence

<220>

<223> variable region after mutation of A6 framework

<400> 36

Met Ser Gln Gln Gly Glu Glu Asp Pro Gln Ala Leu Ser Ile Gln Glu

1 5 10 15

Gly Glu Asn Ala Thr Ile Asn Cys Ser Tyr Lys Thr Ser Ile Asn Asn

20 25 30

Leu Gln Trp Tyr Arg Gln Asp Pro Gly Arg Gly Leu Val His Leu Ile

35 40 45

Leu Ile Arg Ser Asn Glu Arg Glu Lys His Ser Gly Arg Leu Arg Val

50 55 60

Thr Leu Asp Thr Ser Lys Lys Ser Ser Ser Leu Glu Ile Thr Ala Thr

65 70 75 80

Arg Pro Ala Asp Thr Ala Ser Tyr Phe Cys Ala Tyr Asp Glu Asn Ala

85 90 95

Arg Leu Met Phe Gly Asp Gly Thr Gln Leu Thr Val Asn

100 105

<210> 37

<211> 109

<212> PRT

<213> Artificial Sequence

<220>

<223> variable region after mutation of A7 framework

<400> 37

Met Ser Gln Gln Gly Glu Glu Asp Pro Gln Ala Leu Ser Ile Gln Glu

1 5 10 15

Gly Glu Asn Ala Thr Ile Asn Cys Ser Tyr Lys Thr Ser Ile Asn Asn

20 25 30

Leu Gln Trp Tyr Arg Gln Asp Pro Gly Arg Gly Leu Val His Leu Ile

35 40 45

Leu Ile Arg Ser Asn Glu Arg Glu Lys His Ser Gly Arg Leu Arg Val

50 55 60

Thr Leu Asp Thr Ser Lys Lys Ser Ser Ser Leu Glu Ile Thr Ala Thr

65 70 75 80

Arg Pro Ala Asp Thr Ala Ser Tyr Phe Cys Ala Tyr Asp Val Ala Ala

85 90 95

Arg Leu Met Phe Gly Asp Gly Thr Gln Leu Thr Val Asn

100 105

<210> 38

<211> 109

<212> PRT

<213> Artificial Sequence

<220>

<223> variable region after mutation of A8 framework

<400> 38

Met Ser Gln Gln Gly Glu Glu Asp Pro Gln Ala Leu Ser Ile Gln Glu

1 5 10 15

Gly Glu Asn Ala Thr Ile Asn Cys Ser Tyr Lys Thr Ser Ile Asn Asn

20 25 30

Leu Gln Trp Tyr Arg Gln Asp Pro Gly Arg Gly Leu Val His Leu Ile

35 40 45

Leu Ile Arg Ser Asn Glu Arg Glu Lys His Ser Gly Arg Leu Arg Val

50 55 60

Thr Leu Asp Thr Ser Lys Lys Ser Ser Ser Leu Glu Ile Thr Ala Thr

65 70 75 80

Arg Pro Ala Asp Thr Ala Ser Tyr Phe Cys Gly Tyr Asp Gln Asp Ala

85 90 95

Arg Leu Met Phe Gly Asp Gly Thr Gln Leu Thr Val Asn

100 105

<210> 39

<211> 109

<212> PRT

<213> Artificial Sequence

<220>

<223> variable region after mutation of A9 framework

<400> 39

Met Ser Gln Gln Gly Glu Glu Asp Pro Gln Ala Leu Ser Ile Gln Glu

1 5 10 15

Gly Glu Asn Ala Thr Ile Asn Cys Ser Tyr Lys Thr Ser Ile Asn Asn

20 25 30

Leu Gln Trp Tyr Arg Gln Asp Pro Gly Arg Gly Leu Val His Leu Ile

35 40 45

Leu Ile Arg Ser Asn Glu Arg Glu Lys His Ser Gly Arg Leu Arg Val

50 55 60

Thr Leu Asp Thr Ser Lys Lys Ser Ser Ser Leu Glu Ile Thr Ala Thr

65 70 75 80

Arg Pro Ala Asp Thr Ala Ser Tyr Phe Cys Ser Tyr Asp Gln Glu Ala

85 90 95

Arg Leu Met Phe Gly Asp Gly Thr Gln Leu Thr Val Asn

100 105

<210> 40

<211> 109

<212> PRT

<213> Artificial Sequence

<220>

<223> variable region after mutation of A10 framework

<400> 40

Met Ser Gln Gln Gly Glu Glu Asp Pro Gln Ala Leu Ser Ile Gln Glu

1 5 10 15

Gly Glu Asn Ala Thr Ile Asn Cys Ser Tyr Lys Thr Ser Ile Asn Asn

20 25 30

Leu Gln Trp Tyr Arg Gln Asp Pro Gly Arg Gly Leu Val His Leu Ile

35 40 45

Leu Ile Arg Ser Asn Glu Arg Glu Lys His Ser Gly Arg Leu Arg Val

50 55 60

Thr Leu Asp Thr Ser Lys Lys Ser Ser Ser Leu Glu Ile Thr Ala Thr

65 70 75 80

Arg Pro Ala Asp Thr Ala Ser Tyr Phe Cys Val Tyr Asp Gln Asn Ala

85 90 95

Arg Leu Met Phe Gly Asp Gly Thr Gln Leu Thr Val Asn

100 105

<210> 41

<211> 109

<212> PRT

<213> Artificial Sequence

<220>

<223> variable region after mutation of A11 framework

<400> 41

Met Ser Gln Gln Gly Glu Glu Asp Pro Gln Ala Leu Ser Ile Gln Glu

1 5 10 15

Gly Glu Asn Ala Thr Ile Asn Cys Ser Tyr Lys Thr Ser Ile Asn Asn

20 25 30

Leu Gln Trp Tyr Arg Gln Asp Pro Gly Arg Gly Leu Val His Leu Ile

35 40 45

Leu Ile Arg Ser Asn Glu Arg Glu Lys His Ser Gly Arg Leu Arg Val

50 55 60

Thr Leu Asp Thr Ser Lys Lys Ser Ser Ser Leu Glu Ile Thr Ala Thr

65 70 75 80

Arg Pro Ala Asp Thr Ala Ser Tyr Phe Cys Ala Tyr Asp Gln Trp Ala

85 90 95

Arg Leu Met Phe Gly Asp Gly Thr Gln Leu Thr Val Asn

100 105

<210> 42

<211> 112

<212> PRT

<213> Homo sapiens

<400> 42

Asp Ala Gly Val Ile Gln Ser Pro Arg His Glu Val Thr Glu Met Gly

1 5 10 15

Gln Glu Val Thr Leu Arg Cys Lys Pro Ile Ser Gly His Asp Tyr Leu

20 25 30

Phe Trp Tyr Arg Gln Thr Met Met Arg Gly Leu Glu Leu Leu Ile Tyr

35 40 45

Phe Asn Asn Asn Val Pro Ile Asp Asp Ser Gly Met Pro Glu Asp Arg

50 55 60

Phe Ser Ala Lys Met Pro Asn Ala Ser Phe Ser Thr Leu Lys Ile Gln

65 70 75 80

Pro Ser Glu Pro Arg Asp Ser Ala Val Tyr Phe Cys Ala Ser Ser Leu

85 90 95

Gly Pro Gly Glu Leu Phe Phe Gly Glu Gly Ser Arg Leu Thr Val Leu

100 105 110

<210> 43

<211> 112

<212> PRT

<213> Artificial Sequence

<220>

<223> variable region of B1

<400> 43

Asp Ala Gly Val Ile Gln Ser Pro Arg His Glu Val Thr Glu Met Gly

1 5 10 15

Gln Glu Val Thr Leu Arg Cys Lys Pro Ile Ser Gly His Asp Tyr Leu

20 25 30

Phe Trp Tyr Arg Gln Thr Met Met Arg Gly Leu Glu Leu Leu Ile Tyr

35 40 45

Phe Asn Asn Asn Val Pro Ile Asp Asp Ser Gly Met Pro Glu Asp Arg

50 55 60

Phe Ser Ala Lys Met Pro Asn Ala Ser Phe Ser Thr Leu Lys Ile Gln

65 70 75 80

Pro Ser Glu Pro Arg Asp Ser Ala Val Tyr Phe Cys Ala Ser Ser Leu

85 90 95

Gly Ala Asn Glu Leu Phe Phe Gly Glu Gly Ser Arg Leu Thr Val Leu

100 105 110

<210> 44

<211> 112

<212> PRT

<213> Artificial Sequence

<220>

<223> variable region of B2

<400> 44

Asp Ala Gly Val Ile Gln Ser Pro Arg His Glu Val Thr Glu Met Gly

1 5 10 15

Gln Glu Val Thr Leu Arg Cys Lys Pro Ile Ser Gly His Asp Tyr Leu

20 25 30

Phe Trp Tyr Arg Gln Thr Met Met Arg Gly Leu Glu Leu Leu Ile Tyr

35 40 45

Phe Asn Asn Asn Val Pro Ile Asp Asp Ser Gly Met Pro Glu Asp Arg

50 55 60

Phe Ser Ala Lys Met Pro Asn Ala Ser Phe Ser Thr Leu Lys Ile Gln

65 70 75 80

Pro Ser Glu Pro Arg Asp Ser Ala Val Tyr Phe Cys Ala Ser Ser His

85 90 95

Gly Ala Asn Glu Leu Phe Phe Gly Glu Gly Ser Arg Leu Thr Val Leu

100 105 110

<210> 45

<211> 112

<212> PRT

<213> Artificial Sequence

<220>

<223> variable region of B3

<400> 45

Asp Ala Gly Val Ile Gln Ser Pro Arg His Glu Val Thr Glu Met Gly

1 5 10 15

Gln Glu Val Thr Leu Arg Cys Lys Pro Ile Ser Gly His Asp Tyr Leu

20 25 30

Phe Trp Tyr Arg Gln Thr Met Met Arg Gly Leu Glu Leu Leu Ile Tyr

35 40 45

Phe Asn Asn Asn Val Pro Ile Asp Asp Ser Gly Met Pro Glu Asp Arg

50 55 60

Phe Ser Ala Lys Met Pro Asn Ala Ser Phe Ser Thr Leu Lys Ile Gln

65 70 75 80

Pro Ser Glu Pro Arg Asp Ser Ala Val Tyr Phe Cys Ala Ser Ser Leu

85 90 95

Gly Ser Asn Glu Leu Phe Phe Gly Glu Gly Ser Arg Leu Thr Val Leu

100 105 110

<210> 46

<211> 112

<212> PRT

<213> Artificial Sequence

<220>

<223> variable region of B4

<400> 46

Asp Ala Gly Val Ile Gln Ser Pro Arg His Glu Val Thr Glu Met Gly

1 5 10 15

Gln Glu Val Thr Leu Arg Cys Lys Pro Ile Ser Gly His Asp Tyr Leu

20 25 30

Phe Trp Tyr Arg Gln Thr Met Met Arg Gly Leu Glu Leu Leu Ile Tyr

35 40 45

Phe Asn Asn Asn Val Pro Ile Asp Asp Ser Gly Met Pro Glu Asp Arg

50 55 60

Phe Ser Ala Lys Met Pro Asn Ala Ser Phe Ser Thr Leu Lys Ile Gln

65 70 75 80

Pro Ser Glu Pro Arg Asp Ser Ala Val Tyr Phe Cys Ala Ser Ser Arg

85 90 95

Gly Ser Asn Glu Leu Phe Phe Gly Glu Gly Ser Arg Leu Thr Val Leu

100 105 110

<210> 47

<211> 112

<212> PRT

<213> Artificial Sequence

<220>

<223> variable region after mutation of B0 framework

<400> 47

Asp Ala Gly Val Thr Gln Ser Pro Arg His Ile Thr Val Pro Gln Gly

1 5 10 15

Gln Glu Val Thr Leu Arg Cys Lys Pro Ile Ser Gly His Asp Tyr Leu

20 25 30

Phe Trp Tyr Arg Gln Asp Pro Gly Arg Gly Leu Glu Leu Leu Ile Tyr

35 40 45

Phe Asn Asn Asn Val Pro Ile Asp Asp Ser Gly Met Pro Glu Asp Arg

50 55 60

Phe Ser Ala Lys Met Pro Asn Ala Ser His Ser Thr Leu Lys Ile Gln

65 70 75 80

Pro Ser Glu Pro Arg Asp Ser Ala Val Tyr Phe Cys Ala Ser Ser Leu

85 90 95

Gly Pro Gly Glu Leu Phe Phe Gly Glu Gly Ser Arg Leu Thr Val Asn

100 105 110

<210> 48

<211> 112

<212> PRT

<213> Artificial Sequence

<220>

<223> variable region after mutation of B1 framework

<400> 48

Asp Ala Gly Val Thr Gln Ser Pro Arg His Ile Thr Val Pro Gln Gly

1 5 10 15

Gln Glu Val Thr Leu Arg Cys Lys Pro Ile Ser Gly His Asp Tyr Leu

20 25 30

Phe Trp Tyr Arg Gln Asp Pro Gly Arg Gly Leu Glu Leu Leu Ile Tyr

35 40 45

Phe Asn Asn Asn Val Pro Ile Asp Asp Ser Gly Met Pro Glu Asp Arg

50 55 60

Phe Ser Ala Lys Met Pro Asn Ala Ser His Ser Thr Leu Lys Ile Gln

65 70 75 80

Pro Ser Glu Pro Arg Asp Ser Ala Val Tyr Phe Cys Ala Ser Ser Leu

85 90 95

Gly Ala Asn Glu Leu Phe Phe Gly Glu Gly Ser Arg Leu Thr Val Asn

100 105 110

<210> 49

<211> 112

<212> PRT

<213> Artificial Sequence

<220>

<223> variable region after mutation of B2 framework

<400> 49

Asp Ala Gly Val Thr Gln Ser Pro Arg His Ile Thr Val Pro Gln Gly

1 5 10 15

Gln Glu Val Thr Leu Arg Cys Lys Pro Ile Ser Gly His Asp Tyr Leu

20 25 30

Phe Trp Tyr Arg Gln Asp Pro Gly Arg Gly Leu Glu Leu Leu Ile Tyr

35 40 45

Phe Asn Asn Asn Val Pro Ile Asp Asp Ser Gly Met Pro Glu Asp Arg

50 55 60

Phe Ser Ala Lys Met Pro Asn Ala Ser His Ser Thr Leu Lys Ile Gln

65 70 75 80

Pro Ser Glu Pro Arg Asp Ser Ala Val Tyr Phe Cys Ala Ser Ser His

85 90 95

Gly Ala Asn Glu Leu Phe Phe Gly Glu Gly Ser Arg Leu Thr Val Asn

100 105 110

<210> 50

<211> 112

<212> PRT

<213> Artificial Sequence

<220>

<223> variable region after mutation of B3 framework

<400> 50

Asp Ala Gly Val Thr Gln Ser Pro Arg His Ile Thr Val Pro Gln Gly

1 5 10 15

Gln Glu Val Thr Leu Arg Cys Lys Pro Ile Ser Gly His Asp Tyr Leu

20 25 30

Phe Trp Tyr Arg Gln Asp Pro Gly Arg Gly Leu Glu Leu Leu Ile Tyr

35 40 45

Phe Asn Asn Asn Val Pro Ile Asp Asp Ser Gly Met Pro Glu Asp Arg

50 55 60

Phe Ser Ala Lys Met Pro Asn Ala Ser His Ser Thr Leu Lys Ile Gln

65 70 75 80

Pro Ser Glu Pro Arg Asp Ser Ala Val Tyr Phe Cys Ala Ser Ser Leu

85 90 95

Gly Ser Asn Glu Leu Phe Phe Gly Glu Gly Ser Arg Leu Thr Val Asn

100 105 110

<210> 51

<211> 112

<212> PRT

<213> Artificial Sequence

<220>

<223> variable region after mutation of B4 framework

<400> 51

Asp Ala Gly Val Thr Gln Ser Pro Arg His Ile Thr Val Pro Gln Gly

1 5 10 15

Gln Glu Val Thr Leu Arg Cys Lys Pro Ile Ser Gly His Asp Tyr Leu

20 25 30

Phe Trp Tyr Arg Gln Asp Pro Gly Arg Gly Leu Glu Leu Leu Ile Tyr

35 40 45

Phe Asn Asn Asn Val Pro Ile Asp Asp Ser Gly Met Pro Glu Asp Arg

50 55 60

Phe Ser Ala Lys Met Pro Asn Ala Ser His Ser Thr Leu Lys Ile Gln

65 70 75 80

Pro Ser Glu Pro Arg Asp Ser Ala Val Tyr Phe Cys Ala Ser Ser Arg

85 90 95

Gly Ser Asn Glu Leu Phe Phe Gly Glu Gly Ser Arg Leu Thr Val Asn

100 105 110

<210> 52

<211> 270

<212> PRT

<213> Homo sapiens

<400> 52

Met Glu Thr Leu Leu Gly Val Ser Leu Val Ile Leu Trp Leu Gln Leu

1 5 10 15

Ala Arg Val Asn Ser Gln Gln Gly Glu Glu Asp Pro Gln Ala Leu Ser

20 25 30

Ile Gln Glu Gly Glu Asn Ala Thr Met Asn Cys Ser Tyr Lys Thr Ser

35 40 45

Ile Asn Asn Leu Gln Trp Tyr Arg Gln Asn Ser Gly Arg Gly Leu Val

50 55 60

His Leu Ile Leu Ile Arg Ser Asn Glu Arg Glu Lys His Ser Gly Arg

65 70 75 80

Leu Arg Val Thr Leu Asp Thr Ser Lys Lys Ser Ser Ser Leu Leu Ile

85 90 95

Thr Ala Ser Arg Ala Ala Asp Thr Ala Ser Tyr Phe Cys Ala Ser Asp

100 105 110

Gln Asp Ala Arg Leu Met Phe Gly Asp Gly Thr Gln Leu Val Val Lys

115 120 125

Pro Asn Ile Gln Asn Pro Asp Pro Ala Val Tyr Gln Leu Arg Asp Ser

130 135 140

Lys Ser Ser Asp Lys Ser Val Cys Leu Phe Thr Asp Phe Asp Ser Gln

145 150 155 160

Thr Asn Val Ser Gln Ser Lys Asp Ser Asp Val Tyr Ile Thr Asp Lys

165 170 175

Thr Val Leu Asp Met Arg Ser Met Asp Phe Lys Ser Asn Ser Ala Val

180 185 190

Ala Trp Ser Asn Lys Ser Asp Phe Ala Cys Ala Asn Ala Phe Asn Asn

195 200 205

Ser Ile Ile Pro Glu Asp Thr Phe Phe Pro Ser Pro Glu Ser Ser Cys

210 215 220

Asp Val Lys Leu Val Glu Lys Ser Phe Glu Thr Asp Thr Asn Leu Asn

225 230 235 240

Phe Gln Asn Leu Ser Val Ile Gly Phe Arg Ile Leu Leu Leu Lys Val

245 250 255

Ala Gly Phe Asn Leu Leu Met Thr Leu Arg Leu Trp Ser Ser

260 265 270

<210> 53

<211> 310

<212> PRT

<213> Homo sapiens

<400> 53

Met Asp Ser Trp Thr Leu Cys Cys Val Ser Leu Cys Ile Leu Val Ala

1 5 10 15

Lys His Thr Asp Ala Gly Val Ile Gln Ser Pro Arg His Glu Val Thr

20 25 30

Glu Met Gly Gln Glu Val Thr Leu Arg Cys Lys Pro Ile Ser Gly His

35 40 45

Asp Tyr Leu Phe Trp Tyr Arg Gln Thr Met Met Arg Gly Leu Glu Leu

50 55 60

Leu Ile Tyr Phe Asn Asn Asn Val Pro Ile Asp Asp Ser Gly Met Pro

65 70 75 80

Glu Asp Arg Phe Ser Ala Lys Met Pro Asn Ala Ser Phe Ser Thr Leu

85 90 95

Lys Ile Gln Pro Ser Glu Pro Arg Asp Ser Ala Val Tyr Phe Cys Ala

100 105 110

Ser Ser Leu Gly Pro Gly Glu Leu Phe Phe Gly Glu Gly Ser Arg Leu

115 120 125

Thr Val Leu Glu Asp Leu Lys Asn Val Phe Pro Pro Glu Val Ala Val

130 135 140

Phe Glu Pro Ser Glu Ala Glu Ile Ser His Thr Gln Lys Ala Thr Leu

145 150 155 160

Val Cys Leu Ala Thr Gly Phe Tyr Pro Asp His Val Glu Leu Ser Trp

165 170 175

Trp Val Asn Gly Lys Glu Val His Ser Gly Val Ser Thr Asp Pro Gln

180 185 190

Pro Leu Lys Glu Gln Pro Ala Leu Asn Asp Ser Arg Tyr Cys Leu Ser

195 200 205

Ser Arg Leu Arg Val Ser Ala Thr Phe Trp Gln Asn Pro Arg Asn His

210 215 220

Phe Arg Cys Gln Val Gln Phe Tyr Gly Leu Ser Glu Asn Asp Glu Trp

225 230 235 240

Thr Gln Asp Arg Ala Lys Pro Val Thr Gln Ile Val Ser Ala Glu Ala

245 250 255

Trp Gly Arg Ala Asp Cys Gly Phe Thr Ser Glu Ser Tyr Gln Gln Gly

260 265 270

Val Leu Ser Ala Thr Ile Leu Tyr Glu Ile Leu Leu Gly Lys Ala Thr

275 280 285

Leu Tyr Ala Val Leu Val Ser Ala Leu Val Leu Met Ala Met Val Lys

290 295 300

Arg Lys Asp Ser Arg Gly

305 310

<210> 54

<211> 221

<212> PRT

<213> Homo sapiens

<400> 54

Met Ser Gln Gln Gly Glu Glu Asp Pro Gln Ala Leu Ser Ile Gln Glu

1 5 10 15

Gly Glu Asn Ala Thr Met Asn Cys Ser Tyr Lys Thr Ser Ile Asn Asn

20 25 30

Leu Gln Trp Tyr Arg Gln Asn Ser Gly Arg Gly Leu Val His Leu Ile

35 40 45

Leu Ile Arg Ser Asn Glu Arg Glu Lys His Ser Gly Arg Leu Arg Val

50 55 60

Thr Leu Asp Thr Ser Lys Lys Ser Ser Ser Leu Leu Ile Thr Ala Ser

65 70 75 80

Arg Ala Ala Asp Thr Ala Ser Tyr Phe Cys Ala Ser Asp Gln Asp Ala

85 90 95

Arg Leu Met Phe Gly Asp Gly Thr Gln Leu Val Val Lys Pro Asn Ile

100 105 110

Gln Asn Pro Asp Pro Ala Val Tyr Gln Leu Arg Asp Ser Lys Ser Ser

115 120 125

Asp Lys Ser Val Cys Leu Phe Thr Asp Phe Asp Ser Gln Thr Asn Val

130 135 140

Ser Gln Ser Lys Asp Ser Asp Val Tyr Ile Thr Asp Lys Thr Val Leu

145 150 155 160

Asp Met Arg Ser Met Asp Phe Lys Ser Asn Ser Ala Val Ala Trp Ser

165 170 175

Asn Lys Ser Asp Phe Ala Cys Ala Asn Ala Phe Asn Asn Ser Ile Ile

180 185 190

Pro Glu Asp Thr Phe Phe Pro Ser Pro Glu Ser Ser Cys Asp Val Lys

195 200 205

Leu Val Glu Lys Ser Phe Glu Thr Asp Thr Asn Leu Asn

210 215 220

<210> 55

<211> 221

<212> PRT

<213> Artificial Sequence

<220>

<223> A1

<400> 55

Met Ser Gln Gln Gly Glu Glu Asp Pro Gln Ala Leu Ser Ile Gln Glu

1 5 10 15

Gly Glu Asn Ala Thr Met Asn Cys Ser Tyr Lys Thr Ser Ile Asn Asn

20 25 30

Leu Gln Trp Tyr Arg Gln Asn Ser Gly Arg Gly Leu Val His Leu Ile

35 40 45

Leu Ile Arg Ser Asn Glu Arg Glu Lys His Ser Gly Arg Leu Arg Val

50 55 60

Thr Leu Asp Thr Ser Lys Lys Ser Ser Ser Leu Leu Ile Thr Ala Ser

65 70 75 80

Arg Ala Ala Asp Thr Ala Ser Tyr Phe Cys Ala Tyr Asp Ala Asp Ala

85 90 95

Arg Leu Met Phe Gly Asp Gly Thr Gln Leu Val Val Lys Pro Asn Ile

100 105 110

Gln Asn Pro Asp Pro Ala Val Tyr Gln Leu Arg Asp Ser Lys Ser Ser

115 120 125

Asp Lys Ser Val Cys Leu Phe Thr Asp Phe Asp Ser Gln Thr Asn Val

130 135 140

Ser Gln Ser Lys Asp Ser Asp Val Tyr Ile Thr Asp Lys Thr Val Leu

145 150 155 160

Asp Met Arg Ser Met Asp Phe Lys Ser Asn Ser Ala Val Ala Trp Ser

165 170 175

Asn Lys Ser Asp Phe Ala Cys Ala Asn Ala Phe Asn Asn Ser Ile Ile

180 185 190

Pro Glu Asp Thr Phe Phe Pro Ser Pro Glu Ser Ser Cys Asp Val Lys

195 200 205

Leu Val Glu Lys Ser Phe Glu Thr Asp Thr Asn Leu Asn

210 215 220

<210> 56

<211> 221

<212> PRT

<213> Artificial Sequence

<220>

<223> A2

<400> 56

Met Ser Gln Gln Gly Glu Glu Asp Pro Gln Ala Leu Ser Ile Gln Glu

1 5 10 15

Gly Glu Asn Ala Thr Met Asn Cys Ser Tyr Lys Thr Ser Ile Asn Asn

20 25 30

Leu Gln Trp Tyr Arg Gln Asn Ser Gly Arg Gly Leu Val His Leu Ile

35 40 45

Leu Ile Arg Ser Asn Glu Arg Glu Lys His Ser Gly Arg Leu Arg Val

50 55 60

Thr Leu Asp Thr Ser Lys Lys Ser Ser Ser Leu Leu Ile Thr Ala Ser

65 70 75 80

Arg Ala Ala Asp Thr Ala Ser Tyr Phe Cys Ala Phe Asp Ala His Ala

85 90 95

Arg Leu Met Phe Gly Asp Gly Thr Gln Leu Val Val Lys Pro Asn Ile

100 105 110

Gln Asn Pro Asp Pro Ala Val Tyr Gln Leu Arg Asp Ser Lys Ser Ser

115 120 125

Asp Lys Ser Val Cys Leu Phe Thr Asp Phe Asp Ser Gln Thr Asn Val

130 135 140

Ser Gln Ser Lys Asp Ser Asp Val Tyr Ile Thr Asp Lys Thr Val Leu

145 150 155 160

Asp Met Arg Ser Met Asp Phe Lys Ser Asn Ser Ala Val Ala Trp Ser

165 170 175

Asn Lys Ser Asp Phe Ala Cys Ala Asn Ala Phe Asn Asn Ser Ile Ile

180 185 190

Pro Glu Asp Thr Phe Phe Pro Ser Pro Glu Ser Ser Cys Asp Val Lys

195 200 205

Leu Val Glu Lys Ser Phe Glu Thr Asp Thr Asn Leu Asn

210 215 220

<210> 57

<211> 221

<212> PRT

<213> Artificial Sequence

<220>

<223> A3

<400> 57

Met Ser Gln Gln Gly Glu Glu Asp Pro Gln Ala Leu Ser Ile Gln Glu

1 5 10 15

Gly Glu Asn Ala Thr Met Asn Cys Ser Tyr Lys Thr Ser Ile Asn Asn

20 25 30

Leu Gln Trp Tyr Arg Gln Asn Ser Gly Arg Gly Leu Val His Leu Ile

35 40 45

Leu Ile Arg Ser Asn Glu Arg Glu Lys His Ser Gly Arg Leu Arg Val

50 55 60

Thr Leu Asp Thr Ser Lys Lys Ser Ser Ser Leu Leu Ile Thr Ala Ser

65 70 75 80

Arg Ala Ala Asp Thr Ala Ser Tyr Phe Cys Ala Tyr Asp Glu His Ala

85 90 95

Arg Leu Met Phe Gly Asp Gly Thr Gln Leu Val Val Lys Pro Asn Ile

100 105 110

Gln Asn Pro Asp Pro Ala Val Tyr Gln Leu Arg Asp Ser Lys Ser Ser

115 120 125

Asp Lys Ser Val Cys Leu Phe Thr Asp Phe Asp Ser Gln Thr Asn Val

130 135 140

Ser Gln Ser Lys Asp Ser Asp Val Tyr Ile Thr Asp Lys Thr Val Leu

145 150 155 160

Asp Met Arg Ser Met Asp Phe Lys Ser Asn Ser Ala Val Ala Trp Ser

165 170 175

Asn Lys Ser Asp Phe Ala Cys Ala Asn Ala Phe Asn Asn Ser Ile Ile

180 185 190

Pro Glu Asp Thr Phe Phe Pro Ser Pro Glu Ser Ser Cys Asp Val Lys

195 200 205

Leu Val Glu Lys Ser Phe Glu Thr Asp Thr Asn Leu Asn

210 215 220

<210> 58

<211> 221

<212> PRT

<213> Artificial Sequence

<220>

<223> A4

<400> 58

Met Ser Gln Gln Gly Glu Glu Asp Pro Gln Ala Leu Ser Ile Gln Glu

1 5 10 15

Gly Glu Asn Ala Thr Met Asn Cys Ser Tyr Lys Thr Ser Ile Asn Asn

20 25 30

Leu Gln Trp Tyr Arg Gln Asn Ser Gly Arg Gly Leu Val His Leu Ile

35 40 45

Leu Ile Arg Ser Asn Glu Arg Glu Lys His Ser Gly Arg Leu Arg Val

50 55 60

Thr Leu Asp Thr Ser Lys Lys Ser Ser Ser Leu Leu Ile Thr Ala Ser

65 70 75 80

Arg Ala Ala Asp Thr Ala Ser Tyr Phe Cys Ala Tyr Asp Val His Ala

85 90 95

Arg Leu Met Phe Gly Asp Gly Thr Gln Leu Val Val Lys Pro Asn Ile

100 105 110

Gln Asn Pro Asp Pro Ala Val Tyr Gln Leu Arg Asp Ser Lys Ser Ser

115 120 125

Asp Lys Ser Val Cys Leu Phe Thr Asp Phe Asp Ser Gln Thr Asn Val

130 135 140

Ser Gln Ser Lys Asp Ser Asp Val Tyr Ile Thr Asp Lys Thr Val Leu

145 150 155 160

Asp Met Arg Ser Met Asp Phe Lys Ser Asn Ser Ala Val Ala Trp Ser

165 170 175

Asn Lys Ser Asp Phe Ala Cys Ala Asn Ala Phe Asn Asn Ser Ile Ile

180 185 190

Pro Glu Asp Thr Phe Phe Pro Ser Pro Glu Ser Ser Cys Asp Val Lys

195 200 205

Leu Val Glu Lys Ser Phe Glu Thr Asp Thr Asn Leu Asn

210 215 220

<210> 59

<211> 221

<212> PRT

<213> Artificial Sequence

<220>

<223> A5

<400> 59

Met Ser Gln Gln Gly Glu Glu Asp Pro Gln Ala Leu Ser Ile Gln Glu

1 5 10 15

Gly Glu Asn Ala Thr Met Asn Cys Ser Tyr Lys Thr Ser Ile Asn Asn

20 25 30

Leu Gln Trp Tyr Arg Gln Asn Ser Gly Arg Gly Leu Val His Leu Ile

35 40 45

Leu Ile Arg Ser Asn Glu Arg Glu Lys His Ser Gly Arg Leu Arg Val

50 55 60

Thr Leu Asp Thr Ser Lys Lys Ser Ser Ser Leu Leu Ile Thr Ala Ser

65 70 75 80

Arg Ala Ala Asp Thr Ala Ser Tyr Phe Cys Ala Tyr Asp Gln Asp Ala

85 90 95

Arg Leu Met Phe Gly Asp Gly Thr Gln Leu Val Val Lys Pro Asn Ile

100 105 110

Gln Asn Pro Asp Pro Ala Val Tyr Gln Leu Arg Asp Ser Lys Ser Ser

115 120 125

Asp Lys Ser Val Cys Leu Phe Thr Asp Phe Asp Ser Gln Thr Asn Val

130 135 140

Ser Gln Ser Lys Asp Ser Asp Val Tyr Ile Thr Asp Lys Thr Val Leu

145 150 155 160

Asp Met Arg Ser Met Asp Phe Lys Ser Asn Ser Ala Val Ala Trp Ser

165 170 175

Asn Lys Ser Asp Phe Ala Cys Ala Asn Ala Phe Asn Asn Ser Ile Ile

180 185 190

Pro Glu Asp Thr Phe Phe Pro Ser Pro Glu Ser Ser Cys Asp Val Lys

195 200 205

Leu Val Glu Lys Ser Phe Glu Thr Asp Thr Asn Leu Asn

210 215 220

<210> 60

<211> 221

<212> PRT

<213> Artificial Sequence

<220>

<223> A6

<400> 60

Met Ser Gln Gln Gly Glu Glu Asp Pro Gln Ala Leu Ser Ile Gln Glu

1 5 10 15

Gly Glu Asn Ala Thr Met Asn Cys Ser Tyr Lys Thr Ser Ile Asn Asn

20 25 30

Leu Gln Trp Tyr Arg Gln Asn Ser Gly Arg Gly Leu Val His Leu Ile

35 40 45

Leu Ile Arg Ser Asn Glu Arg Glu Lys His Ser Gly Arg Leu Arg Val

50 55 60

Thr Leu Asp Thr Ser Lys Lys Ser Ser Ser Leu Leu Ile Thr Ala Ser

65 70 75 80

Arg Ala Ala Asp Thr Ala Ser Tyr Phe Cys Ala Tyr Asp Glu Asn Ala

85 90 95

Arg Leu Met Phe Gly Asp Gly Thr Gln Leu Val Val Lys Pro Asn Ile

100 105 110

Gln Asn Pro Asp Pro Ala Val Tyr Gln Leu Arg Asp Ser Lys Ser Ser

115 120 125

Asp Lys Ser Val Cys Leu Phe Thr Asp Phe Asp Ser Gln Thr Asn Val

130 135 140

Ser Gln Ser Lys Asp Ser Asp Val Tyr Ile Thr Asp Lys Thr Val Leu

145 150 155 160

Asp Met Arg Ser Met Asp Phe Lys Ser Asn Ser Ala Val Ala Trp Ser

165 170 175

Asn Lys Ser Asp Phe Ala Cys Ala Asn Ala Phe Asn Asn Ser Ile Ile

180 185 190

Pro Glu Asp Thr Phe Phe Pro Ser Pro Glu Ser Ser Cys Asp Val Lys

195 200 205

Leu Val Glu Lys Ser Phe Glu Thr Asp Thr Asn Leu Asn

210 215 220

<210> 61

<211> 221

<212> PRT

<213> Artificial Sequence

<220>

<223> A7

<400> 61

Met Ser Gln Gln Gly Glu Glu Asp Pro Gln Ala Leu Ser Ile Gln Glu

1 5 10 15

Gly Glu Asn Ala Thr Met Asn Cys Ser Tyr Lys Thr Ser Ile Asn Asn

20 25 30

Leu Gln Trp Tyr Arg Gln Asn Ser Gly Arg Gly Leu Val His Leu Ile

35 40 45

Leu Ile Arg Ser Asn Glu Arg Glu Lys His Ser Gly Arg Leu Arg Val

50 55 60

Thr Leu Asp Thr Ser Lys Lys Ser Ser Ser Leu Leu Ile Thr Ala Ser

65 70 75 80

Arg Ala Ala Asp Thr Ala Ser Tyr Phe Cys Ala Tyr Asp Val Ala Ala

85 90 95

Arg Leu Met Phe Gly Asp Gly Thr Gln Leu Val Val Lys Pro Asn Ile

100 105 110

Gln Asn Pro Asp Pro Ala Val Tyr Gln Leu Arg Asp Ser Lys Ser Ser

115 120 125

Asp Lys Ser Val Cys Leu Phe Thr Asp Phe Asp Ser Gln Thr Asn Val

130 135 140

Ser Gln Ser Lys Asp Ser Asp Val Tyr Ile Thr Asp Lys Thr Val Leu

145 150 155 160

Asp Met Arg Ser Met Asp Phe Lys Ser Asn Ser Ala Val Ala Trp Ser

165 170 175

Asn Lys Ser Asp Phe Ala Cys Ala Asn Ala Phe Asn Asn Ser Ile Ile

180 185 190

Pro Glu Asp Thr Phe Phe Pro Ser Pro Glu Ser Ser Cys Asp Val Lys

195 200 205

Leu Val Glu Lys Ser Phe Glu Thr Asp Thr Asn Leu Asn

210 215 220

<210> 62

<211> 221

<212> PRT

<213> Artificial Sequence

<220>

<223> A8

<400> 62

Met Ser Gln Gln Gly Glu Glu Asp Pro Gln Ala Leu Ser Ile Gln Glu

1 5 10 15

Gly Glu Asn Ala Thr Met Asn Cys Ser Tyr Lys Thr Ser Ile Asn Asn

20 25 30

Leu Gln Trp Tyr Arg Gln Asn Ser Gly Arg Gly Leu Val His Leu Ile

35 40 45

Leu Ile Arg Ser Asn Glu Arg Glu Lys His Ser Gly Arg Leu Arg Val

50 55 60

Thr Leu Asp Thr Ser Lys Lys Ser Ser Ser Leu Leu Ile Thr Ala Ser

65 70 75 80

Arg Ala Ala Asp Thr Ala Ser Tyr Phe Cys Gly Tyr Asp Gln Asp Ala

85 90 95

Arg Leu Met Phe Gly Asp Gly Thr Gln Leu Val Val Lys Pro Asn Ile

100 105 110

Gln Asn Pro Asp Pro Ala Val Tyr Gln Leu Arg Asp Ser Lys Ser Ser

115 120 125

Asp Lys Ser Val Cys Leu Phe Thr Asp Phe Asp Ser Gln Thr Asn Val

130 135 140

Ser Gln Ser Lys Asp Ser Asp Val Tyr Ile Thr Asp Lys Thr Val Leu

145 150 155 160

Asp Met Arg Ser Met Asp Phe Lys Ser Asn Ser Ala Val Ala Trp Ser

165 170 175

Asn Lys Ser Asp Phe Ala Cys Ala Asn Ala Phe Asn Asn Ser Ile Ile

180 185 190

Pro Glu Asp Thr Phe Phe Pro Ser Pro Glu Ser Ser Cys Asp Val Lys

195 200 205

Leu Val Glu Lys Ser Phe Glu Thr Asp Thr Asn Leu Asn

210 215 220

<210> 63

<211> 221

<212> PRT

<213> Artificial Sequence

<220>

<223> A9

<400> 63

Met Ser Gln Gln Gly Glu Glu Asp Pro Gln Ala Leu Ser Ile Gln Glu

1 5 10 15

Gly Glu Asn Ala Thr Met Asn Cys Ser Tyr Lys Thr Ser Ile Asn Asn

20 25 30

Leu Gln Trp Tyr Arg Gln Asn Ser Gly Arg Gly Leu Val His Leu Ile

35 40 45

Leu Ile Arg Ser Asn Glu Arg Glu Lys His Ser Gly Arg Leu Arg Val

50 55 60

Thr Leu Asp Thr Ser Lys Lys Ser Ser Ser Leu Leu Ile Thr Ala Ser

65 70 75 80

Arg Ala Ala Asp Thr Ala Ser Tyr Phe Cys Ser Tyr Asp Gln Glu Ala

85 90 95

Arg Leu Met Phe Gly Asp Gly Thr Gln Leu Val Val Lys Pro Asn Ile

100 105 110

Gln Asn Pro Asp Pro Ala Val Tyr Gln Leu Arg Asp Ser Lys Ser Ser

115 120 125

Asp Lys Ser Val Cys Leu Phe Thr Asp Phe Asp Ser Gln Thr Asn Val

130 135 140

Ser Gln Ser Lys Asp Ser Asp Val Tyr Ile Thr Asp Lys Thr Val Leu

145 150 155 160

Asp Met Arg Ser Met Asp Phe Lys Ser Asn Ser Ala Val Ala Trp Ser

165 170 175

Asn Lys Ser Asp Phe Ala Cys Ala Asn Ala Phe Asn Asn Ser Ile Ile

180 185 190

Pro Glu Asp Thr Phe Phe Pro Ser Pro Glu Ser Ser Cys Asp Val Lys

195 200 205

Leu Val Glu Lys Ser Phe Glu Thr Asp Thr Asn Leu Asn

210 215 220

<210> 64

<211> 221

<212> PRT

<213> Artificial Sequence

<220>

<223> A10

<400> 64

Met Ser Gln Gln Gly Glu Glu Asp Pro Gln Ala Leu Ser Ile Gln Glu

1 5 10 15

Gly Glu Asn Ala Thr Met Asn Cys Ser Tyr Lys Thr Ser Ile Asn Asn

20 25 30

Leu Gln Trp Tyr Arg Gln Asn Ser Gly Arg Gly Leu Val His Leu Ile

35 40 45

Leu Ile Arg Ser Asn Glu Arg Glu Lys His Ser Gly Arg Leu Arg Val

50 55 60

Thr Leu Asp Thr Ser Lys Lys Ser Ser Ser Leu Leu Ile Thr Ala Ser

65 70 75 80

Arg Ala Ala Asp Thr Ala Ser Tyr Phe Cys Val Tyr Asp Gln Asn Ala

85 90 95

Arg Leu Met Phe Gly Asp Gly Thr Gln Leu Val Val Lys Pro Asn Ile

100 105 110

Gln Asn Pro Asp Pro Ala Val Tyr Gln Leu Arg Asp Ser Lys Ser Ser

115 120 125

Asp Lys Ser Val Cys Leu Phe Thr Asp Phe Asp Ser Gln Thr Asn Val

130 135 140

Ser Gln Ser Lys Asp Ser Asp Val Tyr Ile Thr Asp Lys Thr Val Leu

145 150 155 160

Asp Met Arg Ser Met Asp Phe Lys Ser Asn Ser Ala Val Ala Trp Ser

165 170 175

Asn Lys Ser Asp Phe Ala Cys Ala Asn Ala Phe Asn Asn Ser Ile Ile

180 185 190

Pro Glu Asp Thr Phe Phe Pro Ser Pro Glu Ser Ser Cys Asp Val Lys

195 200 205

Leu Val Glu Lys Ser Phe Glu Thr Asp Thr Asn Leu Asn

210 215 220

<210> 65

<211> 221

<212> PRT

<213> Artificial Sequence

<220>

<223> A11

<400> 65

Met Ser Gln Gln Gly Glu Glu Asp Pro Gln Ala Leu Ser Ile Gln Glu

1 5 10 15

Gly Glu Asn Ala Thr Met Asn Cys Ser Tyr Lys Thr Ser Ile Asn Asn

20 25 30

Leu Gln Trp Tyr Arg Gln Asn Ser Gly Arg Gly Leu Val His Leu Ile

35 40 45

Leu Ile Arg Ser Asn Glu Arg Glu Lys His Ser Gly Arg Leu Arg Val

50 55 60

Thr Leu Asp Thr Ser Lys Lys Ser Ser Ser Leu Leu Ile Thr Ala Ser

65 70 75 80

Arg Ala Ala Asp Thr Ala Ser Tyr Phe Cys Ala Tyr Asp Gln Trp Ala

85 90 95

Arg Leu Met Phe Gly Asp Gly Thr Gln Leu Val Val Lys Pro Asn Ile

100 105 110

Gln Asn Pro Asp Pro Ala Val Tyr Gln Leu Arg Asp Ser Lys Ser Ser

115 120 125

Asp Lys Ser Val Cys Leu Phe Thr Asp Phe Asp Ser Gln Thr Asn Val

130 135 140

Ser Gln Ser Lys Asp Ser Asp Val Tyr Ile Thr Asp Lys Thr Val Leu

145 150 155 160

Asp Met Arg Ser Met Asp Phe Lys Ser Asn Ser Ala Val Ala Trp Ser

165 170 175

Asn Lys Ser Asp Phe Ala Cys Ala Asn Ala Phe Asn Asn Ser Ile Ile

180 185 190

Pro Glu Asp Thr Phe Phe Pro Ser Pro Glu Ser Ser Cys Asp Val Lys

195 200 205

Leu Val Glu Lys Ser Phe Glu Thr Asp Thr Asn Leu Asn

210 215 220

<210> 66

<211> 259

<212> PRT

<213> Homo sapiens

<400> 66

Met Asp Ala Gly Val Ile Gln Ser Pro Arg His Glu Val Thr Glu Met

1 5 10 15

Gly Gln Glu Val Thr Leu Arg Cys Lys Pro Ile Ser Gly His Asp Tyr

20 25 30

Leu Phe Trp Tyr Arg Gln Thr Met Met Arg Gly Leu Glu Leu Leu Ile

35 40 45

Tyr Phe Asn Asn Asn Val Pro Ile Asp Asp Ser Gly Met Pro Glu Asp

50 55 60

Arg Phe Ser Ala Lys Met Pro Asn Ala Ser Phe Ser Thr Leu Lys Ile

65 70 75 80

Gln Pro Ser Glu Pro Arg Asp Ser Ala Val Tyr Phe Cys Ala Ser Ser

85 90 95

Leu Gly Pro Gly Glu Leu Phe Phe Gly Glu Gly Ser Arg Leu Thr Val

100 105 110

Leu Glu Asp Leu Lys Asn Val Phe Pro Pro Glu Val Ala Val Phe Glu

115 120 125

Pro Ser Glu Ala Glu Ile Ser His Thr Gln Lys Ala Thr Leu Val Cys

130 135 140

Leu Ala Thr Gly Phe Tyr Pro Asp His Val Glu Leu Ser Trp Trp Val

145 150 155 160

Asn Gly Lys Glu Val His Ser Gly Val Ser Thr Asp Pro Gln Pro Leu

165 170 175

Lys Glu Gln Pro Ala Leu Asn Asp Ser Arg Tyr Cys Leu Ser Ser Arg

180 185 190

Leu Arg Val Ser Ala Thr Phe Trp Gln Asn Pro Arg Asn His Phe Arg

195 200 205

Cys Gln Val Gln Phe Tyr Gly Leu Ser Glu Asn Asp Glu Trp Thr Gln

210 215 220

Asp Arg Ala Lys Pro Val Thr Gln Ile Val Ser Ala Glu Ala Trp Gly

225 230 235 240

Arg Ala Asp Cys Gly Phe Thr Ser Glu Ser Tyr Gln Gln Gly Val Leu

245 250 255

Ser Ala Thr

<210> 67

<211> 259

<212> PRT

<213> Artificial Sequence

<220>

<223> B1

<400> 67

Met Asp Ala Gly Val Ile Gln Ser Pro Arg His Glu Val Thr Glu Met

1 5 10 15

Gly Gln Glu Val Thr Leu Arg Cys Lys Pro Ile Ser Gly His Asp Tyr

20 25 30

Leu Phe Trp Tyr Arg Gln Thr Met Met Arg Gly Leu Glu Leu Leu Ile

35 40 45

Tyr Phe Asn Asn Asn Val Pro Ile Asp Asp Ser Gly Met Pro Glu Asp

50 55 60

Arg Phe Ser Ala Lys Met Pro Asn Ala Ser Phe Ser Thr Leu Lys Ile

65 70 75 80

Gln Pro Ser Glu Pro Arg Asp Ser Ala Val Tyr Phe Cys Ala Ser Ser

85 90 95

Leu Gly Ala Asn Glu Leu Phe Phe Gly Glu Gly Ser Arg Leu Thr Val

100 105 110

Leu Glu Asp Leu Lys Asn Val Phe Pro Pro Glu Val Ala Val Phe Glu

115 120 125

Pro Ser Glu Ala Glu Ile Ser His Thr Gln Lys Ala Thr Leu Val Cys

130 135 140

Leu Ala Thr Gly Phe Tyr Pro Asp His Val Glu Leu Ser Trp Trp Val

145 150 155 160

Asn Gly Lys Glu Val His Ser Gly Val Ser Thr Asp Pro Gln Pro Leu

165 170 175

Lys Glu Gln Pro Ala Leu Asn Asp Ser Arg Tyr Cys Leu Ser Ser Arg

180 185 190

Leu Arg Val Ser Ala Thr Phe Trp Gln Asn Pro Arg Asn His Phe Arg

195 200 205

Cys Gln Val Gln Phe Tyr Gly Leu Ser Glu Asn Asp Glu Trp Thr Gln

210 215 220

Asp Arg Ala Lys Pro Val Thr Gln Ile Val Ser Ala Glu Ala Trp Gly

225 230 235 240

Arg Ala Asp Cys Gly Phe Thr Ser Glu Ser Tyr Gln Gln Gly Val Leu

245 250 255

Ser Ala Thr

<210> 68

<211> 259

<212> PRT

<213> Artificial Sequence

<220>

<223> B2

<400> 68

Met Asp Ala Gly Val Ile Gln Ser Pro Arg His Glu Val Thr Glu Met

1 5 10 15

Gly Gln Glu Val Thr Leu Arg Cys Lys Pro Ile Ser Gly His Asp Tyr

20 25 30

Leu Phe Trp Tyr Arg Gln Thr Met Met Arg Gly Leu Glu Leu Leu Ile

35 40 45

Tyr Phe Asn Asn Asn Val Pro Ile Asp Asp Ser Gly Met Pro Glu Asp

50 55 60

Arg Phe Ser Ala Lys Met Pro Asn Ala Ser Phe Ser Thr Leu Lys Ile

65 70 75 80

Gln Pro Ser Glu Pro Arg Asp Ser Ala Val Tyr Phe Cys Ala Ser Ser

85 90 95

His Gly Ala Asn Glu Leu Phe Phe Gly Glu Gly Ser Arg Leu Thr Val

100 105 110

Leu Glu Asp Leu Lys Asn Val Phe Pro Pro Glu Val Ala Val Phe Glu

115 120 125

Pro Ser Glu Ala Glu Ile Ser His Thr Gln Lys Ala Thr Leu Val Cys

130 135 140

Leu Ala Thr Gly Phe Tyr Pro Asp His Val Glu Leu Ser Trp Trp Val

145 150 155 160

Asn Gly Lys Glu Val His Ser Gly Val Ser Thr Asp Pro Gln Pro Leu

165 170 175

Lys Glu Gln Pro Ala Leu Asn Asp Ser Arg Tyr Cys Leu Ser Ser Arg

180 185 190

Leu Arg Val Ser Ala Thr Phe Trp Gln Asn Pro Arg Asn His Phe Arg

195 200 205

Cys Gln Val Gln Phe Tyr Gly Leu Ser Glu Asn Asp Glu Trp Thr Gln

210 215 220

Asp Arg Ala Lys Pro Val Thr Gln Ile Val Ser Ala Glu Ala Trp Gly

225 230 235 240

Arg Ala Asp Cys Gly Phe Thr Ser Glu Ser Tyr Gln Gln Gly Val Leu

245 250 255

Ser Ala Thr

<210> 69

<211> 259

<212> PRT

<213> Artificial Sequence

<220>

<223> B3

<400> 69

Met Asp Ala Gly Val Ile Gln Ser Pro Arg His Glu Val Thr Glu Met

1 5 10 15

Gly Gln Glu Val Thr Leu Arg Cys Lys Pro Ile Ser Gly His Asp Tyr

20 25 30

Leu Phe Trp Tyr Arg Gln Thr Met Met Arg Gly Leu Glu Leu Leu Ile

35 40 45

Tyr Phe Asn Asn Asn Val Pro Ile Asp Asp Ser Gly Met Pro Glu Asp

50 55 60

Arg Phe Ser Ala Lys Met Pro Asn Ala Ser Phe Ser Thr Leu Lys Ile

65 70 75 80

Gln Pro Ser Glu Pro Arg Asp Ser Ala Val Tyr Phe Cys Ala Ser Ser

85 90 95

Leu Gly Ser Asn Glu Leu Phe Phe Gly Glu Gly Ser Arg Leu Thr Val

100 105 110

Leu Glu Asp Leu Lys Asn Val Phe Pro Pro Glu Val Ala Val Phe Glu

115 120 125

Pro Ser Glu Ala Glu Ile Ser His Thr Gln Lys Ala Thr Leu Val Cys

130 135 140

Leu Ala Thr Gly Phe Tyr Pro Asp His Val Glu Leu Ser Trp Trp Val

145 150 155 160

Asn Gly Lys Glu Val His Ser Gly Val Ser Thr Asp Pro Gln Pro Leu

165 170 175

Lys Glu Gln Pro Ala Leu Asn Asp Ser Arg Tyr Cys Leu Ser Ser Arg

180 185 190

Leu Arg Val Ser Ala Thr Phe Trp Gln Asn Pro Arg Asn His Phe Arg

195 200 205

Cys Gln Val Gln Phe Tyr Gly Leu Ser Glu Asn Asp Glu Trp Thr Gln

210 215 220

Asp Arg Ala Lys Pro Val Thr Gln Ile Val Ser Ala Glu Ala Trp Gly

225 230 235 240

Arg Ala Asp Cys Gly Phe Thr Ser Glu Ser Tyr Gln Gln Gly Val Leu

245 250 255

Ser Ala Thr

<210> 70

<211> 259

<212> PRT

<213> Artificial Sequence

<220>

<223> B4

<400> 70

Met Asp Ala Gly Val Ile Gln Ser Pro Arg His Glu Val Thr Glu Met

1 5 10 15

Gly Gln Glu Val Thr Leu Arg Cys Lys Pro Ile Ser Gly His Asp Tyr

20 25 30

Leu Phe Trp Tyr Arg Gln Thr Met Met Arg Gly Leu Glu Leu Leu Ile

35 40 45

Tyr Phe Asn Asn Asn Val Pro Ile Asp Asp Ser Gly Met Pro Glu Asp

50 55 60

Arg Phe Ser Ala Lys Met Pro Asn Ala Ser Phe Ser Thr Leu Lys Ile

65 70 75 80

Gln Pro Ser Glu Pro Arg Asp Ser Ala Val Tyr Phe Cys Ala Ser Ser

85 90 95

Arg Gly Ser Asn Glu Leu Phe Phe Gly Glu Gly Ser Arg Leu Thr Val

100 105 110

Leu Glu Asp Leu Lys Asn Val Phe Pro Pro Glu Val Ala Val Phe Glu

115 120 125

Pro Ser Glu Ala Glu Ile Ser His Thr Gln Lys Ala Thr Leu Val Cys

130 135 140

Leu Ala Thr Gly Phe Tyr Pro Asp His Val Glu Leu Ser Trp Trp Val

145 150 155 160

Asn Gly Lys Glu Val His Ser Gly Val Ser Thr Asp Pro Gln Pro Leu

165 170 175

Lys Glu Gln Pro Ala Leu Asn Asp Ser Arg Tyr Cys Leu Ser Ser Arg

180 185 190

Leu Arg Val Ser Ala Thr Phe Trp Gln Asn Pro Arg Asn His Phe Arg

195 200 205

Cys Gln Val Gln Phe Tyr Gly Leu Ser Glu Asn Asp Glu Trp Thr Gln

210 215 220

Asp Arg Ala Lys Pro Val Thr Gln Ile Val Ser Ala Glu Ala Trp Gly

225 230 235 240

Arg Ala Asp Cys Gly Phe Thr Ser Glu Ser Tyr Gln Gln Gly Val Leu

245 250 255

Ser Ala Thr

<210> 71

<211> 5

<212> PRT

<213> Homo sapiens

<400> 71

Thr Ser Ile Asn Asn

1 5

<210> 72

<211> 7

<212> PRT

<213> Homo sapiens

<400> 72

Ile Arg Ser Asn Glu Arg Glu

1 5

<210> 73

<211> 5

<212> PRT

<213> Homo sapiens

<400> 73

Ser Gly His Asp Tyr

1 5

<210> 74

<211> 6

<212> PRT

<213> Homo sapiens

<400> 74

Phe Asn Asn Asn Val Pro

1 5