Method for synthesizing sitagliptin and intermediate thereof through biocatalysis

文档序号:913950 发布日期:2021-02-26 浏览:25次 中文

阅读说明:本技术 一种生物催化合成西他列汀及其中间体的方法 (Method for synthesizing sitagliptin and intermediate thereof through biocatalysis ) 是由 吴法浩 杨文� 李钢 史宏伟 高仰哲 刘丽莉 袁志法 于 2018-07-27 设计创作,主要内容包括:提供一种生物催化合成西他列汀及其中间体的方法,具体提供式I和式II所示化合物、或其药学上可接受的盐,一种能够催化所述式I化合物生成式II化合物的多肽,编码所述多肽的核酸,含有所述核酸的载体和细胞。此外,还提供使用所述多肽和式I化合物来生产式II化合物以及西他列汀的方法,以及制备所述多肽的方法。(Provided are a method for synthesizing sitagliptin and an intermediate thereof through biocatalysis, in particular to a compound shown in formula I and a compound shown in formula II, or pharmaceutically acceptable salt thereof, a polypeptide capable of catalyzing the compound shown in formula I to generate the compound shown in formula II, a nucleic acid for coding the polypeptide, a vector containing the nucleic acid and a cell. In addition, methods of using the polypeptides and compounds of formula I to produce compounds of formula II and sitagliptin, and methods of making the polypeptides are also provided.)

1. A compound of formula I, or a pharmaceutically acceptable salt thereof,

wherein R is1And R2Each independently selected from hydrogen and C1-6Alkyl, 3-8 membered cycloalkyl, 3-8 membered heterocycloalkyl, 6-10 membered aryl and 5-10 membered heteroaryl; or, R1And R2Form a 4-7 membered heterocyclic ring with the attached N atom;

preferably, R1And R2Each independently selected from hydrogen and C1-4Alkyl, 3-6 membered cycloalkyl, 3-6 membered heterocycloalkyl, 6-10 membered aryl and 5-6 membered heteroaryl; or, R1And R2Form a 5-6 membered aliphatic heterocycle or a 5-6 membered aromatic heterocycle with the attached N atom;

preferably, R1And R2Each independently selected from hydrogen and C1-4An alkyl group; or, R1And R2Form a 5-6 membered aliphatic heterocycle or a 5-6 membered aromatic heterocycle with the attached N atom;

preferably, R1And R2Form a pyrrole ring, an imidazole ring, a pyrrolidine ring, an oxazolidine ring, an isoxazolidine ring, a piperidine ring, a morpholine ring or a piperazine ring with the N atom to which it is attached;

preferably, R1And R2Form a morpholine ring with the attached N atom.

2. A compound of formula II, or a pharmaceutically acceptable salt thereof,

wherein R is1And R2Each independently selected from hydrogen and C1-6Alkyl, 3-8 membered cycloalkyl, 3-8 membered heterocycloalkyl, 6-10 membered aryl and 5-10 membered heteroaryl; or, R1And R2Form a 4-7 membered heterocyclic ring with the attached N atom;

preferably, R1And R2Each independently selected from hydrogen and C1-4Alkyl, 3-6 membered cycloalkyl, 3-6 membered heterocycloalkyl, 6-10 membered aryl and 5-6 membered heteroaryl; or, R1And R2Form a 5-6 membered aliphatic heterocycle or a 5-6 membered aromatic heterocycle with the attached N atom;

preferably, R1And R2Each independently selected from hydrogen and C1-4An alkyl group; or, R1And R2Form a 5-6 membered aliphatic heterocycle or a 5-6 membered aromatic heterocycle with the attached N atom;

preferably, R1And R2Form a pyrrole ring, an imidazole ring, a pyrrolidine ring, an oxazolidine ring, an isoxazolidine ring, a piperidine ring, a morpholine ring or a piperazine ring with the N atom to which it is attached;

preferably, R1And R2Form a morpholine ring with the attached N atom.

3. A polypeptide having activity in catalyzing the conversion of a carbonyl group to an amino group and having an amino acid sequence selected from the group consisting of:

1) 1, as shown in SEQ ID NO;

2) an amino acid sequence having at least 90% identity, preferably at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to SEQ ID NO 1; and

(3) an amino acid sequence that differs from SEQ ID NO:1 by substitution, deletion or addition of one or several (e.g., 1,2, 3, 4,5, 6,7,8 or 9) amino acid residues.

4. An isolated nucleic acid encoding the polypeptide of claim 3.

5. A vector comprising the isolated nucleic acid of claim 4.

6. A cell comprising the isolated nucleic acid of claim 4 and/or the vector of claim 5, wherein the isolated nucleic acid is heterologous or exogenous to the cell.

7. A composition comprising the polypeptide of claim 3.

8. A method of producing a compound of formula II, or a pharmaceutically acceptable salt thereof, comprising the step of converting a compound of formula I to a compound of formula II using the polypeptide of claim 3 or the composition of claim 7, wherein,

the compound of formula I, or a pharmaceutically acceptable salt thereof, is as defined in claim 1;

the compound of formula II, or a pharmaceutically acceptable salt thereof, is as defined in claim 2;

preferably, the method comprises (a) reacting the compound of formula I with an amino donor in the presence of the polypeptide or composition and an amino transporter; (b) collecting the compound of formula II produced in step (a);

further preferably, in step (a), V (ml)Composition comprising a metal oxide and a metal oxide:m(g)A compound of formula I(2-5): 1; more preferably, the amount of said polypeptide is 10-80 wt.% of said compound of formula I; in step (a), the amino donor is selected from C1-6Alkylamines (e.g. isopropylamine) and inorganic ammonium salts (e.g. ammonium formate, ammonium chloride or ammonium sulfate), preferably isopropylamine; preferably, the molar ratio of the compound of formula I to the amino donor is 1: (1-3) (e.g., 1 (1.2-3)); preferably, inIn step (a), the amino transfersome is selected from pyridoxal phosphate and pyridoxamine phosphate; preferably, in step (a), the reaction is carried out in an aqueous phase, and further preferably the compound of formula I is dissolved in an alcoholic solvent (such as methanol, ethanol or isopropanol) and added to the reaction system (for example, the compound of formula I is dissolved in an alcoholic solvent to form a solution of 1-5Kg/L, such as 1-4Kg/L, such as 3-4 Kg/L); preferably, the concentration of the compound of formula I in the reaction system is 100g/L-250 g/L; preferably, in step (a), the reaction is carried out at 30-50 ℃ (preferably 45 ℃); preferably, in step (a), the pH of the reaction system is 7.0 to 9.0 (preferably 8.0 to 9.0), and further preferably, the pH of the reaction system is adjusted with an organic amine (e.g., isopropylamine, butylamine, or pentylamine); preferably, in step (a), the reaction system is contacted with air;

further preferably, in step (b), the compound of formula II is collected by: extracting the product obtained in step (a) with an organic solvent, concentrating, further preferably the organic solvent is selected from dichloromethane, ethyl acetate and isopropyl acetate.

9. A method for synthesizing sitagliptin or a salt thereof, comprising the steps of:

the first step is as follows: carrying out asymmetric catalytic reaction on the compound of the formula I to generate a compound of a formula II;

the second step is that: hydrolyzing the compound of formula II in the presence of a base to obtain a compound of formula III;

the third step: protecting amino in the compound of the formula III to obtain a compound of a formula IV;

the fourth step: carrying out condensation reaction on the compound of the formula IV and the compound of the formula V, and removing an amino protecting group to generate sitagliptin or salt thereof;

wherein, -Pg represents an amino protecting group, for example Boc, Cbz, Fmoc or Alloc;

R1and R2Is as defined in claim 1.

10. The method of claim 9, characterized by one or more of the following:

(1) the compound of formula I is prepared by the following method:

a) compound 1 and compound 2 are purified in an aprotic solvent (e.g., in EtOAc, DCM, DMF, DMA, or DMSO; preferably DMA), in the presence of an organic base (e.g. methylamine, triethylamine, n-butylamine or tert-butylamine; preferably triethylamine), at room temperature or with heat (e.g. 20-50 ℃; preferably 35 ℃) to form compound 3; preferably, the molar ratio of compound 1 to compound 2 is 1: (1-5); preferably, the reaction at room temperature or after heating further comprises a step of adding an acidifying agent, and further preferably, the acidifying agent is selected from hydrochloric acid, thionyl chloride and pivaloyl chloride, and hydrochloric acid is preferred; preferably, the acidifying agent is added in an amount such that the reaction system pH is acidic;

b) compound 3 with NHR1R2In a non-alcoholic solvent (such as benzene, toluene or tetralin), heating (such as 40-120 ℃; such as 100-; preferably, Compound 3 is reacted with NHR1R2In a molar ratio of 1: (2-4);

(2) in a first step, the asymmetric catalytic reaction is an asymmetric reductive amination reaction, preferably the catalyst catalyzing the reductive amination is selected from metal complex catalysts of chiral rhodium, palladium and ruthenium;

(3) in a first step, the catalyst used for the asymmetric catalytic reaction is the polypeptide of claim 3 or the composition of claim 7; preferably, the asymmetric catalytic reaction conditions are as defined in claim 8;

(4) in the second step, the base is an inorganic base, such as sodium hydroxide or potassium hydroxide;

(5) in the third step, the Boc anhydride is reacted with a compound of formula III in the presence of a base for amino protection; preferably, the molar ratio of the compound of formula III, Boc anhydride and base is 1: (1.5-3): (2-4); preferably, the base is selected from sodium hydroxide, potassium hydroxide and triethylamine;

(6) in the fourth step, the compound of formula IV is subjected to condensation reaction with the compound of formula V through the active intermediate thereof; preferably, the reactive intermediate of the compound of formula IV is in its acid chloride, anhydride or amide form; preferably, the molar ratio of the compound of formula IV to the compound of formula V is 1: (1-1.2); preferably, the condensation reaction is carried out in a non-alcoholic solvent (e.g. ethyl acetate, dichloromethane or trichloromethane); preferably, the condensation reaction is carried out at room temperature (e.g., 25 ℃); preferably, the condensation reaction is carried out in the presence of a base, further preferably, the base is triethylamine.

11. A method of making the polypeptide of claim 3, comprising, (a) culturing a host cell comprising and expressing a nucleic acid encoding the polypeptide; and, (b) collecting said polypeptide expressed by said cells.

12. Use of a compound of claim 1 or 2, or a pharmaceutically acceptable salt thereof, a polypeptide of claim 3, or a composition of claim 7, in the preparation of sitagliptin or an intermediate thereof.

13. A process for the preparation of sitagliptin or an intermediate thereof, comprising the step of using a compound of claim 1 or 2, or a pharmaceutically acceptable salt thereof, a polypeptide of claim 3 or a composition of claim 7.

Technical Field

The application relates to the technical field of molecular biology, in particular to the field of sitagliptin biosynthesis. Specifically, the application provides a compound shown in formula I and formula II, or pharmaceutically acceptable salt thereof, a polypeptide capable of catalyzing the compound shown in formula I to generate the compound shown in formula II, a nucleic acid for encoding the polypeptide, a vector containing the nucleic acid and a cell. In addition, methods of using the polypeptides and compounds of formula I to produce compounds of formula II and sitagliptin, and methods of making the polypeptides are also provided.

Background

Sitagliptin (the structure is shown as the following) with the chemical name of (3R) -3-amino-1- [3- (trifluoromethyl) -5,6,7, 8-tetrahydro-1, 2, 4-triazolo [4,3-a ] pyrazin-7-yl ] -4- (2,4, 5-trifluorophenyl) butan-1-one, and is an oral hypoglycemic agent. It can be used alone or combined with other oral hypoglycemic agents to form compound medicine (such as metformin or thiazolidinedione) for treating type 2 diabetes. Compared with other oral hypoglycemic agents, sitagliptin has fewer side effects (lower probability of causing hypoglycemia and weight gain) in controlling the glucose content in blood.

The structure of sitagliptin contains a chiral center, and the construction of the chiral center is the most critical step for synthesizing sitagliptin. The construction methods of the chiral center in the existing research mainly include the following methods: (1) carrying out asymmetric hydrogenation on an enamine substrate by using a chiral catalyst; (2) taking a chiral ammonia compound as a raw material; (3) chiral resolution; (4) beta-carbonyl ester compounds are used as substrates and are prepared by transaminase catalysis. However, the above methods have problems such as high cost, low chiral purity, difficulty in post-treatment, and low yield.

In recent years, the bio-enzyme method has the advantages of high selectivity and environmental friendliness, and gradually becomes a preferable scheme for synthesizing chiral medicinal chemicals and intermediates thereof.

Transaminase (transaminase), also called aminotransferase, is a key enzyme for asymmetric synthesis of highly optically pure chiral ammonia and is widely distributed in animals, plants and microorganisms. To date, many ω -transaminase genes have been cloned, and part of the genes of aminotransferases have been expressed in different hosts (E.coli, Pichia pastoris, etc.). Strains which can produce omega-aminotransferase with high enzyme activity and selectivity are also obtained. Omega-transaminases are also currently used for the production of sitagliptin. However, few natural ω -transaminases have been reported for R-type selective transamination, and these ω -transaminases catalyze a narrow spectrum of substrates and are often the most suitable biocatalysts to screen for a particular reaction.

Therefore, the method for constructing the sitagliptin chiral center, especially the biological enzyme method, is searched for and provides a new choice for solving the problems in the drug synthesis.

Disclosure of Invention

A new enzyme is obtained by mutating the wild type arthrobacter transaminase gene sequence, and can stereospecifically catalyze beta-carbonyl amide to generate R-type chiral amine. Based on the above, the inventors developed a new method for synthesizing sitagliptin.

Thus, in one aspect, the present application provides a key intermediate for the construction of sitagliptin chiral center, which is a β -carbonyl amide compound that can be used as a substrate for the enzyme, stereospecifically converted to the R-form amine. The key intermediate for constructing the sitagliptin chiral center is a compound shown in a formula I or pharmaceutically acceptable salt thereof,

wherein R is1And R2Each independently selected from hydrogen and C1-6Alkyl, 3-8 membered cycloalkyl, 3-8 membered heterocycloalkyl, 6-10 membered aryl and 5-10 membered heteroaryl; or, R1And R2Form a 4-7 membered heterocyclic ring with the attached N atom.

In certain preferred embodiments, R1And R2Each independently selected from hydrogen and C1-4Alkyl, 3-6 membered cycloalkyl, 3-6 membered heterocycloalkyl, 6-10 membered aryl and 5-6 membered heteroaryl; or, R1And R2Form a 5-6 membered aliphatic heterocyclic ring or a 5-6 membered aromatic heterocyclic ring with the attached N atom.

In certain preferred embodiments, R1And R2Each independently selected from hydrogen and C1-4An alkyl group; or, R1And R2Form a 5-6 membered aliphatic heterocyclic ring or a 5-6 membered aromatic heterocyclic ring with the attached N atom.

In certain preferred embodiments, R1And R2Form a pyrrole ring, an imidazole ring, a pyrrolidine ring, an oxazolidine ring, an isoxazolidine ring, a piperidine ring, a morpholine ring or a piperazine ring with the attached N atom.

In certain preferred embodiments, R1And R2Form a pyrrole ring with the attached N atom.

In certain preferred embodiments,R1And R2Form an imidazole ring with the attached N atom.

In certain preferred embodiments, R1And R2Forming a pyrrolidine ring with the attached N atom.

In certain preferred embodiments, R1And R2Form an oxazolidine ring with the attached N atom.

In certain preferred embodiments, R1And R2Form an isoxazolidine ring with the attached N atom.

In certain preferred embodiments, R1And R2Form a piperidine ring with the attached N atom.

In certain preferred embodiments, R1And R2Form a morpholine ring with the attached N atom.

In certain preferred embodiments, R1And R2Form a piperazine ring with the attached N atom.

In another aspect, the application provides a compound of the chiral intermediate of sitagliptin of formula II, or a pharmaceutically acceptable salt thereof,

wherein R is1And R2Each independently selected from hydrogen and C1-6Alkyl, 3-8 membered cycloalkyl, 3-8 membered heterocycloalkyl, 6-10 membered aryl and 5-10 membered heteroaryl; or, R1And R2Form a 4-7 membered heterocyclic ring with the attached N atom.

In certain preferred embodiments, R1And R2Each independently selected from hydrogen and C1-4Alkyl, 3-6 membered cycloalkyl, 3-6 membered heterocycloalkyl, 6-10 membered aryl and 5-6 membered heteroaryl; or, R1And R2Form a 5-6 membered aliphatic heterocyclic ring or a 5-6 membered aromatic heterocyclic ring with the attached N atom.

In certain preferred embodiments, R1And R2Each independently selected from hydrogen and C1-4An alkyl group; or, R1And R2Form a 5-6 membered aliphatic heterocyclic ring or a 5-6 membered aromatic heterocyclic ring with the attached N atom.

In certain preferred embodiments, R1And R2Form a pyrrole ring, an imidazole ring, a pyrrolidine ring, an oxazolidine ring, an isoxazolidine ring, a piperidine ring, a morpholine ring or a piperazine ring with the attached N atom.

In certain preferred embodiments, R1And R2Form a pyrrole ring with the attached N atom.

In certain preferred embodiments, R1And R2Form an imidazole ring with the attached N atom.

In certain preferred embodiments, R1And R2Forming a pyrrolidine ring with the attached N atom.

In certain preferred embodiments, R1And R2Form an oxazolidine ring with the attached N atom.

In certain preferred embodiments, R1And R2Form an isoxazolidine ring with the attached N atom.

In certain preferred embodiments, R1And R2Form a piperidine ring with the attached N atom.

In certain preferred embodiments, R1And R2Form a morpholine ring with the attached N atom.

In certain preferred embodiments, R1And R2Form a piperazine ring with the attached N atom.

In another aspect, the present application provides a polypeptide having activity in catalyzing the conversion of a carbonyl group to an amino group, and having an amino acid sequence selected from the group consisting of:

1) 1, as shown in SEQ ID NO;

2) an amino acid sequence having at least 90% identity to SEQ ID NO. 1; and

(3) an amino acid sequence which differs from SEQ ID NO 1 by substitution, deletion or addition of one or several amino acid residues.

In certain preferred embodiments, the amino acid sequence of a polypeptide described herein has at least 90% identity, preferably at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to SEQ ID No. 1.

In certain preferred embodiments, the amino acid sequence of the polypeptides described herein differs from SEQ ID NO:1 by the substitution, deletion, or addition of one or several (e.g., 1,2, 3, 4,5, 6,7,8, or 9) amino acid residues.

In certain preferred embodiments, the polypeptides described herein have activity in catalyzing the production of a compound of formula I to a compound of formula II, wherein the compounds of formula I and formula II are defined herein.

In another aspect, the present application provides an isolated nucleic acid encoding a polypeptide as described above.

In another aspect, the present application also provides a vector comprising the isolated nucleic acid. In certain preferred embodiments, the isolated nucleic acids described herein encode a polypeptide having the amino acid sequence of SEQ ID NO. 1. Vectors useful for inserting the nucleotide of interest are well known in the art and include, but are not limited to, cloning vectors and expression vectors. In one embodiment, the vector may be, for example, a plasmid, cosmid, phage, or the like.

In another aspect, the present application also provides a cell comprising the isolated nucleic acid and/or the vector described above. Such host cells include, but are not limited to, prokaryotic cells such as E.coli cells and Bacillus cells (e.g., Bacillus alkalophilus, Bacillus subtilis), and eukaryotic cells such as yeast cells, insect cells, plant cells, and animal cells. In certain preferred embodiments, the isolated nucleic acid is heterologous or exogenous to the cell.

In another aspect, the present application also provides a composition comprising a polypeptide as described above.

In certain preferred embodiments, the composition is prepared by:

(a) culturing a host cell comprising and expressing a nucleic acid encoding a polypeptide as hereinbefore described; (b) collecting and crushing the host cells to obtain cell crushing liquid; (c) filtering the cell disruption solution; and (d) collecting the filtrate; optionally, further comprising the step of diluting the filtrate with PBS at pH 8.0.

In certain preferred embodiments, the host cells are collected by centrifugation or membrane filtration; preferably, after the host cells are collected by centrifugation or membrane filtration, a process of washing the host cells with a phosphate buffer solution is further included. In some preferred embodiments, the host cell is disrupted by an ultrasonicator or a high pressure homogenizer. In some preferred embodiments, the cell disruption solution is centrifuged prior to filtration. In some preferred embodiments, the composition comprises 10 wt.% to 20 wt.% of the polypeptide, e.g., 10 wt.%, 11 wt.%, 12 wt.%, 13 wt.%, 14 wt.%, 15 wt.%, 16 wt.%, 17 wt.%, 18 wt.%, 19 wt.%, or 20 wt.%.

In another aspect, the present application provides a method of producing a compound of formula II, or a pharmaceutically acceptable salt thereof, comprising the step of converting a compound of formula I to a compound of formula II using a polypeptide or composition as described above, wherein,

the compounds of formula I and formula II, or pharmaceutically acceptable salts thereof, are as hereinbefore defined.

In certain preferred embodiments, the method comprises (a) reacting the compound of formula I with an amino donor in the presence of the polypeptide or composition and an amino mediator; (b) collecting the compound of formula II produced in step (a).

The amount of catalyst used can be determined according to conventional techniques in the art. In certain preferred embodiments, in step (a), V (ml)Composition comprising a metal oxide and a metal oxide:m(g)A compound of formula I1, e.g. (4-5): 1, 2:1, 2.5:1, 3:1, 3.5:1, 4:1, 4.5:1 or 5: 1. In some preferred embodiments, the amount of the polypeptide is 10 wt.% to 80 wt.%, e.g., 10 wt.%, 20 wt.%, 30 wt.%, 40 wt.%, 50 wt.%, 60 wt.% of the compound of formula I.% 70 wt.% or 80 wt.%.

In certain preferred embodiments, in step (a), the amino donor is selected from C1-6Alkyl amines and inorganic ammonium salts. In certain preferred embodiments, said C1-6The alkylamine is isopropylamine. In certain preferred embodiments, the inorganic ammonium salt is selected from ammonium formate, ammonium chloride, and ammonium sulfate. In certain preferred embodiments, the amino donor is isopropylamine. In certain preferred embodiments, the molar ratio of the compound of formula I to the amino donor is 1: (1-3). In certain preferred embodiments, the molar ratio of the compound of formula I to the amino donor is 1: (1.2-3).

In certain preferred embodiments, in step (a), the amino transfersome is selected from pyridoxal phosphate and pyridoxamine phosphate.

In certain preferred embodiments, in step (a), the reaction is carried out in an aqueous phase. In certain preferred embodiments, the compound of formula I may be dissolved in an alcoholic solvent and then added to the reaction system. In certain preferred embodiments, the compound of formula I may be dissolved in an alcoholic solvent to a solution of 1 to 5Kg/L, for example 1 to 4Kg/L, for example 3 to 4 Kg/L. In certain preferred embodiments, the alcoholic reagent is selected from methanol, ethanol, and isopropanol. In certain preferred embodiments, the concentration of the compound of formula I in the reaction system is 100-250 g/L.

In certain preferred embodiments, in step (a), the reaction is carried out at 30-50 ℃. In certain preferred embodiments, in step (a), the reaction is carried out at 45 ℃.

In certain preferred embodiments, in step (a), the reaction system has a pH of 7.0 to 9.0. In certain preferred embodiments, the reaction system has a pH of from 8.0 to 9.0. In certain preferred embodiments, the reaction system pH is adjusted with an organic amine. In certain preferred embodiments, the organic amine is selected from the group consisting of isopropylamine, butylamine, and pentylamine.

In certain preferred embodiments, in step (a), the reaction system is contacted with air.

In certain preferred embodiments, in step (b), the compound of formula II is collected by: extracting the product obtained in the step (a) by using an organic solvent and concentrating. In certain preferred embodiments, the organic solvent is selected from the group consisting of dichloromethane, ethyl acetate, and isopropyl acetate.

In another aspect, the present application provides a method for synthesizing sitagliptin or a salt thereof, comprising the steps of:

the first step is as follows: carrying out asymmetric catalytic reaction on the compound of the formula I to generate a compound of a formula II;

the second step is that: hydrolyzing the compound of formula II in the presence of a base to obtain a compound of formula III;

the third step: protecting amino in the compound of the formula III to obtain a compound of a formula IV;

the fourth step: carrying out condensation reaction on the compound of the formula IV and the compound of the formula V, and removing an amino protecting group to generate sitagliptin or salt thereof;

wherein, -Pg represents an amino protecting group, R1And R2As defined hereinbefore.

In certain preferred embodiments, the amino protecting group is Boc, Cbz, Fmoc, or Alloc.

In certain preferred embodiments, the compounds of formula I may be prepared by:

a) reacting the compound 1 and the compound 2 in an aprotic solvent in the presence of an organic base at room temperature or under heating to generate a compound 3;

b) compound 3 with NHR1R2Heating in non-alcoholic solvent to obtain the compound of formula I.

In certain preferred embodiments, compound 1 and compound 2 are reacted in EtOAc, DCM, DMF, DMA or DMSO. In certain preferred embodiments, compound 1 and compound 2 are reacted in DMA.

In certain preferred embodiments, compound 1 and compound 2 are reacted in the presence of methylamine, triethylamine, n-butylamine, or tert-butylamine. In certain preferred embodiments, compound 1 and compound 2 are reacted in the presence of triethylamine.

In certain preferred embodiments, compound 1 and compound 2 are reacted at 20-50 ℃. In certain preferred embodiments, compound 1 and compound 2 are reacted at 35 ℃.

In certain preferred embodiments, the molar ratio of compound 1 to compound 2 is 1: (1-5).

In certain preferred embodiments, after reacting compound 1 and compound 2, there is further included the step of adding an acidifying agent. In certain preferred embodiments, the acidifying agent is selected from the group consisting of hydrochloric acid, thionyl chloride, and pivaloyl chloride. In certain preferred embodiments, the acidifying agent is hydrochloric acid. In certain preferred embodiments, the acidifying agent is added in an amount such that the reaction system pH is acidic.

In certain preferred embodiments, compound 3 is reacted with NHR1R2In benzene, toluene or tetralin.

In certain preferred embodiments, compound 3 is reacted with NHR1R2The reaction is carried out by inorganic base catalysis. In certain preferred embodiments, the inorganic base is sodium hydroxide or potassium hydroxide.

In certain preferred embodiments, compound 3 is reacted with NHR1R2The reaction takes place at 40-120 ℃. In certain preferred embodiments, compound 3 is reacted with NHR1R2The reaction takes place at 100-105 ℃.

In certain preferred embodiments, compound 3 is reacted with NHR1R2In a molar ratio of 1: (2-4).

In certain preferred embodiments, in the first step, the asymmetric catalytic reaction is an asymmetric reductive amination reaction. In certain preferred embodiments, the catalyst that catalyzes the reductive amination is selected from metal complex catalysts of chiral rhodium, palladium, and ruthenium. In certain preferred embodiments, the chiral rhodium, palladium, and ruthenium metal complex catalyst is selected from the group consisting of bis (di-t-butylphenyl phosphine) palladium dichloride, (p-cymene) ruthenium, and bis [ (α, α, α ', α' -tetramethyl-1, 3-benzenedipropionic) rhodium ].

In certain preferred embodiments, the catalyst used for the asymmetric catalytic reaction is a polypeptide or composition as described above.

In certain preferred embodiments, the reaction conditions for asymmetrically catalyzing a compound of formula I to a compound of formula II are as defined herein before.

In certain preferred embodiments, the compound of formula II is hydrolyzed in the presence of an inorganic base to provide a compound of formula III. In certain preferred embodiments, the inorganic base is sodium hydroxide or potassium hydroxide.

In certain preferred embodiments, the amino protection is performed by reacting Boc anhydride with a compound of formula III in the presence of a base. In certain preferred embodiments, the molar ratio of the compound of formula III, Boc anhydride and base is 1: (1.5-3): (2-4). In certain preferred embodiments, the base is selected from the group consisting of sodium hydroxide, potassium hydroxide and triethylamine.

In certain preferred embodiments, the compound of formula IV is condensed with the compound of formula V via a reactive intermediate thereof. In certain preferred embodiments, the reactive intermediate of the compound of formula IV is in its acid chloride, anhydride, or amide form.

In certain preferred embodiments, the molar ratio of the compound of formula IV to the compound of formula V is 1: (1-1.2).

In certain preferred embodiments, the condensation reaction is carried out in a non-alcoholic solvent. In certain preferred embodiments, the non-alcoholic reagent is ethyl acetate, dichloromethane or chloroform.

In certain preferred embodiments, the condensation reaction is carried out at room temperature (e.g., 25 ℃).

In certain preferred embodiments, the condensation reaction is carried out in the presence of a base. In certain preferred embodiments, the base is triethylamine.

In another aspect, the present application provides a method of making a polypeptide as described above, comprising, (a) culturing a host cell comprising and expressing a nucleic acid encoding the polypeptide; and, (b) collecting said polypeptide expressed by said cells.

Various host cells for protein expression are well known to those skilled in the art and include, but are not limited to, prokaryotic cells such as E.coli cells, and eukaryotic cells such as yeast cells, insect cells, plant cells, and animal cells (e.g., mammalian cells, e.g., mouse cells, human cells, etc.). Particularly preferably, the host cell is E.coli.

In another aspect, the present application provides the use of a compound of formula I or formula II, or a pharmaceutically acceptable salt thereof, as described hereinbefore, said polypeptide or composition in the preparation of sitagliptin or an intermediate thereof.

In another aspect, the present application provides a method of preparing sitagliptin or an intermediate thereof, comprising the step of using a compound of formula I or formula II, or a pharmaceutically acceptable salt thereof, the polypeptide or the composition as described hereinbefore.

Definition and interpretation of related terms

In the present invention, unless otherwise specified, scientific and technical terms used herein have the meanings that are commonly understood by those skilled in the art. Also, the relevant laboratory procedures used herein are all conventional procedures widely used in the relevant field. Meanwhile, in order to better understand the present invention, the definitions and explanations of related terms are provided below.

As used herein, the term "identity" is used to refer to the match of sequences between two polypeptides or between two nucleic acids. When a position in both of the sequences being compared is occupied by the same base or amino acid monomer subunit (e.g., a position in each of two DNA molecules is occupied by adenine, or a position in each of two polypeptides is occupied by lysine), then the molecules are identical at that position. The "percent identity" between two sequences is a function of the number of matching positions shared by the two sequences divided by the number of positions compared x 100. For example, if 6 of 10 positions of two sequences match, then the two sequences have 60% identity. For example, the DNA sequences CTGACT and CAGGTT share 50% identity (3 of the total 6 positions match). Typically, the comparison is made when the two sequences are aligned to yield maximum identity. Such alignments can be performed by using, for example, Needleman et al (1970) j.mol.biol.48: 443-453. The algorithm of E.Meyers and W.Miller (Compout.appl biosci., 4:11-17(1988)) which has been incorporated into the ALIGN program (version 2.0) can also be used to determine percent identity between two amino acid sequences using a PAM120 weight residue table (weight residue table), a gap length penalty of 12, and a gap penalty of 4. Furthermore, percent identity between two amino acid sequences can be determined using the Needleman and Wunsch (J MoI biol.48: 444-.

As used herein, the expression "nucleic acid/polypeptide is heterologous with respect to the cell" means that the nucleic acid/polypeptide does not naturally occur in the cell. That is, the cell does not naturally contain or express the nucleic acid/polypeptide.

As used herein, the expression "nucleic acid/polypeptide is exogenous with respect to a cell" means that the nucleic acid/polypeptide is exogenously introduced into the cell by artificial means. It will be appreciated that such nucleic acids/polypeptides may not naturally occur in the cell (i.e., heterologous with respect to the cell) for introducing the heterologous nucleic acid/polypeptide into the cell; alternatively, it may be the same endogenous nucleic acid/polypeptide naturally present in the cell, which is used to increase the copy number or expression of the endogenous nucleic acid/polypeptide in the cell.

As used hereinBy the expression "C1-6Alkyl "means a straight or branched chain alkyl group having 1 to 6, i.e., 1,2, 3, 4,5 or 6 carbon atoms, typically methyl, ethyl, n-propyl, isopropyl, n-butyl, isobutyl, sec-butyl, tert-butyl, neopentyl, pentyl, hexyl and the like. Similarly, the term "C1-4Alkyl "means a straight or branched chain alkyl group having 1,2, 3 or 4 carbon atoms, including methyl, ethyl, n-propyl, isopropyl, n-butyl, and the like.

As used herein, the term "3-8 membered cycloalkyl" means a saturated cyclic hydrocarbon group containing 3-8 ring members, which may be a monocyclic or polycyclic fused system, and which may be fused to an aromatic ring. Including, for example, 3-6 membered cycloalkyl, 4-6 membered cycloalkyl, 5-6 membered cycloalkyl, and the like. Examples of such groups include, but are not limited to, cyclopropyl, cyclobutyl, cyclopentyl, and cyclohexyl.

As used herein, the term "3-8 membered heterocycloalkyl" refers to a monocyclic or bicyclic saturated or partially saturated cyclic group containing 3-8 ring members, at least one and up to four of which are heteroatoms independently selected from N, O or S, for example, 3-6 membered heterocycloalkyl, 4-6 membered heterocycloalkyl or 5-6 membered heterocycloalkyl. Preferably, the heteroatoms are 1N, 2N, 1N and 1O or 1N and 1S. Examples of such groups include, but are not limited to, pyrrolidine, oxazolidine, isoxazolidine, imidazolidine, piperidine, morpholine, thiomorpholine, or piperazine rings, and the like.

As used herein, the term "6-10 membered aryl" refers to an aromatic group containing 6-10 ring members comprising at least one aromatic ring. Such as phenyl, naphthyl, and the like.

As used herein, the term "5-10 membered heteroaryl" refers to a group having aromatic character containing 5-10 ring members and at least one of which is a heteroatom independently selected from N, O and S, such as 5-6 membered heteroaryl and the like. Examples of such groups include, but are not limited to, pyrrolyl, furanyl, thienyl, imidazolyl, pyrazolyl, triazolyl, tetrazolyl, oxazolyl, isoxazolyl, oxadiazolyl, thiazolyl, isothiazolyl, thiadiazolyl, pyridyl, pyrimidinyl, triazinyl, benzimidazolyl, benzoxazolyl, benzothiazolyl, benzofuranyl, benzothienyl, indolyl, isoindolyl, pyridazinyl, pyrazinyl, quinolinyl, and the like.

As used herein, the term "4-7 membered heterocyclic ring" refers to a cyclic group containing 4-7 ring members, at least one of which is a heteroatom independently selected from N, O and S. Including 4-7 membered aliphatic and aromatic heterocycles, e.g., 5-6 membered aliphatic and 5-6 membered aromatic heterocycles. Specific examples include, but are not limited to, pyrrolidine ring, imidazolidine ring, oxazolidine ring, isoxazolidine ring, piperidine ring, piperazine ring, morpholine ring, thiomorpholine ring, pyrrole ring, imidazole ring, oxazole ring, imidazole ring, pyrazole ring, triazole ring, tetrazole ring, oxazole ring, isoxazole ring, oxadiazole ring, thiazole ring, isothiazole ring, thiadiazole ring, pyridine ring, pyrimidine ring, triazine ring, pyridazine ring, pyrazine ring and the like.

Amino acids and their designations used herein have the following correspondence:

advantageous effects of the invention

The application provides a polypeptide or a composition containing the polypeptide, which can stereospecifically catalyze beta-carbonyl amide to generate R-type chiral amine, so that the polypeptide can be used for synthesizing sitagliptin. Compared with the synthesis method of sitagliptin and the construction method of the chiral center thereof in the prior art, the synthesis method has the advantages of low cost, simple operation, small environmental pollution, high overall yield and/or high product purity and the like, and is suitable for industrial production.

Embodiments of the present invention will be described in detail below with reference to the drawings and examples, but those skilled in the art will understand that the following drawings and examples are only for illustrating the present invention and do not limit the scope of the present invention. Various objects and advantageous aspects of the present invention will become apparent to those skilled in the art from the accompanying drawings and the following detailed description of the preferred embodiments. The examples, in which specific conditions are not specified, were conducted under conventional conditions or conditions recommended by the manufacturer. The reagents or instruments used are not indicated by the manufacturer, and are all conventional products commercially available.

Drawings

FIG. 1 shows a map of a 00-8 recombinant plasmid;

FIG. 2 shows the cleavage sites of the 00-8 recombinant plasmid;

FIG. 3 shows compound I prepared by example 3.2, Condition 41A HNMR map;

FIG. 4 preparation of Compound IV via example 3.4, Condition 11A HNMR map;

FIG. 5 shows Compound IV prepared according to example 3.4, Condition 21A HNMR map;

FIG. 6 shows Compound IV prepared according to example 3.4, Condition 31A HNMR map;

figure 7 shows a chemical purity HPLC profile of sitagliptin prepared via example 3.5, condition 1;

figure 8 shows a chiral purity HPLC profile of sitagliptin prepared under condition 1 of example 3.5;

figure 9 shows a chemical purity HPLC profile of sitagliptin prepared via example 3.5, condition 2;

figure 10 shows a chiral purity HPLC profile of sitagliptin prepared via example 3.5, condition 2.

Sequence information

Information on the sequences to which the present invention relates is provided in table 1 below.

Table 1: description of the sequences

Sequence 1(SEQ ID NO:1)

SVLHRGQQRRRFHIQFPVTTDNALGNRTRHTVRNGITIDRNERPDATAGGATQNFVSIVQFCRRDIGQNRFVAQRFRDFQNGLARNTRQSCTTRATNHTIFDDNHIKARTFSQQVVTIQQQRQFETAIMGFLDCTNQVAPLKVLHLRINGTTRGATDALCNHQVHTVADTIERNNPLVRARTHIHLRAMFGDITFKRRRAIAAGNRHGDHGFTQFGLGHQFQRDFFDFILRQRRDQANRFCIAEQAFNVVAQTESITVPNMKRGVGCVRRIETLIKDGNTGFTRRHKRTLNPCCTASQRVCRVQFVVAVGNVVQARIVGVNNFRRVCGECHRILAVVMMVMAA

Sequence 2(SEQ ID NO:2)

ATGGCCTCTATGGACAAAGTCTTTTCGGGATATTATGCGCGCCAGAAGCTGCTTGAACGGAGCGACAATCCTTTCTCTAAGGGCATTGCTTATGTGGAAGGAAAGCTCGTCTTTCCTAGTGATGCTAGAATACCGCTACTCGACGAAGGTTTCATGCACAGTGACCTAACCTATGATGTTATATCGGTTTGGGATGGTCGCTTCTTTCGATTGGACGATCATTTGCAACGGATTTTGGAAAGCTGCGATAAGATGCGGCTCAAGTTCCCACTTGCACTGAGCACCGTGGAAAATATTCTGGCTGAGATGGTCGCCAAGAGTGGTATCCGGGATGCGTTTGTGGAAGTTATTGTGACACGTGGTCTGACAGGTGTACGTGGTTCGAAGCCTGAGGATCTGTATAATAACAACATATACCTGCTTGTTCTTCCATACATTTGGGTTATGGCGCCTGAGAACCAGCTCCATGGTGGCGAGGCTATCATTACAAGGACAGTGCGACGAACACCCCCAGGTGCATTTGATCCTACTATCAAAAATCTACAGTGGGGTGATTTAACAAAGGGACTTTTTGAGGCAATGGACCGTGGCGCCACATACCCATTTCTCACTGATGGAGACACCAACCTTACTGAAGGATCTGGTTTCAACATTGTTTTGGTGAAGAACGGTATTATCTATACCCCTGATCGAGGTGTCTTGCGAGGGATCACACGTAAAAGTGTGATTGACGTTGCCCGAGCCAACAGCATCGACATCCGCCTTGAGGTCGTACCAGTGGAGCAGGCTTATCACTCTGATGAGATCTTCATGTGCACAACTGCCGGCGGCATTATGCCTATAACATTGCTTGATGGTCAACCTGTTAATGACGGCCAGGTTGGCCCAATCACAAAGAAGATATGGGATGGCTATTGGGAGATGCACTACAATCCGGCGTATAGTTTTCCTGTTGACTATGGCAGTGGCTAA

Sequence 3(SEQ ID NO:3)

AAAITIITTARIRYCTGVSREEDSTFSSQGRRMIDWVTGPGTPSEIGLPSTETNGQTPPPVVQPRTSSASSSSARVMSARIASGPRDSAISRTVLRVIPGRAAASRPSPSSSSGASKPRSWVSGTARIRSPHWKFLTCGSIEERGVRRTDGATIAGTPSRMRSNGTIHWYGTAYMGTCGRCLVMSRSPGVEEGPRVIETETTASRSSVLATSSRAISLTSSWVSGGMIRIDSALENRRSMWSSRRKALPFQTWNPVGVTSECRGPWSKIEIRASDGGTKAPSIQAAPPASGLAGSSSGSEGVIGSRPVSWVGTISEVSAEKA

Sequence 4(SEQ ID NO:4)

GCAGCAGCCATCACCATCATCACCACAGCCAGGATCCGGTACTGTACCGGGGTCAGCAGAGAAGAAGATTCAACGTTCAGTTCCCAGTAACGACGGATGATAGACTGGGTAACCGGACCCGGAACACCGTCAGAGATCGGGTTACCGTCAACAGAAACGAACGGCCAAACACCACCACCGGTAGTGCAACCCAGAACTTCGTCAGCGTCCAGCAGTTCAGCCAGGGTGATGTCAGCCAGGATAGCTTCGTGACCCAGAGATTCAGCGATTTCCAGAACGGTTTTACGGGTGATACCCGGCAGAGCAGCAGCCAGCAGACCGTCACCGTCCAGCAGCAGCGGAGCTTCGAAACCACGGTCGTGGGTTTCCTGAACTGCACGGATCAGGTCACCCCACTGGAAGTTTTTAACCTGCGGGTCGATAGAAGAACGCGGAGTACGACGAACAGACTGAGCAACCATAGCGTGAACACCGTCACGGATGCGGTCAAACGGTACGATCCACTGGTACGGAACAGCGTACATGTAAACCTGCGGACGATGTTTGGTGATGTCACGTTCACCTGGGGTAGAAGAGTAACCACGGGTGATAGAAACAGAAACGACTGCTTCACGCAGTTCGGTTTTAGCAACCAGTTCCAGAGCGATTTCTTTAACTTCGTCCTGGGTCAGCGGCGGGATGATACGCATAGATTCAGCGTTAGAGAACAGACGTTCGATGTGGTCGTCCAGACGGAAAGCGTTACCGTTCCAAACGTGGAACCCGGTGTAGGTAACGTCAGAGTGCAGGTAACCCTGGTCGAAGATAGAGATACGAGCTTCAGACGGCGGAACGAAAGCACCTTCGATCCAAGCAGCACCACCAGCCAGCGGGTTAGCCGGGTCCAGTTCGTAGTCAGAGTAGGTGATATAGTCCAGACCGGTGTCGTGGGTGTAAACGATTTCAGAGGTGTCAGCAGAGAAAGCCAT

Sequence 5(SEQ ID NO:5)

AAAITIITTARIRYCTGVSREEDSTFSSQGRRMIDWVTGPGTPSEIGLPSTETNGQTPPPVEQPRTSSASSSSARVMSARIASGPRDSAISRTVLRVIPGRAARPGERTTPSLITTTLKPGPSASRPSPSSSSGSSKPRSWVSGIARIRSPHWKFLTCGSIEERGVRRTDGATIAGTPSRMRSNGTIHWYGTAYMGTCGRCLVMSRIYGVEEGPRVIETETIASRSSVLATSSRAISLTSSWVSGGMIRIDSALENRRSMWSSRRKALPFQTWNPVGVASEVRGPWSKIEIRASDGGTKAPSIQAAPPASGLAGSSSWSEGVIGSRPVSWVGTISEVSAEKA

Sequence 6(SEQ ID NO:6)

GCAGCAGCCATCACCATCATCACCACAGCCAGGATCCGGTACTGTACCGGGGTCAGCAGAGAAGAAGATTCAACGTTCAGTTCCCAGTAACGACGGATGATAGACTGGGTAACCGGACCCGGAACACCGTCAGAGATCGGGTTACCGTCAACAGAAACGAACGGCCAAACACCACCACCGGTTGAGCAACCCAGAACTTCGTCAGCGTCCAGCAGTTCAGCCAGGGTGATGTCAGCCAGGATAGCTTCGTGACCCAGAGATTCAGCGATTTCCAGAACGGTTTTACGGGTGATACCCGGCAGAGCAGCACGACCCGGAGAACGAACAACACCGTCTTTGATAACAACAACGTTGAAACCCGGACCTTCAGCCAGCAGACCGTCACCGTCCAGCAGCAGCGGCAGCTCGAAACCACGGTCGTGGGTTTCCTGAATTGCACGGATCAGGTCACCCCACTGGAAGTTTTTAACCTGCGGGTCGATAGAAGAACGCGGAGTACGACGAACAGACTGAGCAACCATAGCGTGAACACCGTCACGGATGCGGTCAAACGGTACGATCCACTGGTACGGAACAGCGTACATGTAAACCTGCGGACGATGTTTGGTGATGTCACGAATATATGGGGTAGAAGAGTAACCACGGGTGATAGAAACAGAAACGATTGCTTCACGCAGTTCGGTTTTAGCAACCAGTTCCAGAGCGATTTCTTTAACTTCGTCCTGGGTCAGCGGCGGGATGATACGCATAGATTCAGCGTTAGAGAACAGACGTTCGATGTGGTCGTCCAGACGGAAAGCGTTACCGTTCCAAACGTGGAACCCGGTGTAGGTAGCGTCAGAGGTCAGGTAACCCTGGTCGAAGATAGAGATACGAGCTTCAGACGGCGGAACGAAAGCACCTTCGATCCAAGCAGCACCACCAGCCAGCGGGTTAGCCGGGTCCAGTTCGTGGTCAGAGTAGGTGATATAGTCCAGACCGGTGTCGTGGGTGTAAACGATTTCAGAGGTGTCAGCAGAGAAAGCCAT

SEQ ID NO:7)

AAAITIITTARIRYCTGVSREEDSTFSSQGRRMIDWVTGPGTPSEIGLPSTETNGQTPPPVEQPRTSSASSSSARVMSARIASGPRDSAISRTVLRVIPGRAARPGERTTPSLITTTLKPGPSASRPSQSSSSGSSKPRSWVSGIARIRSPHWKFLTCGSIEERGVRRTDGATIAGTPSRMRSNGTIHWYGTAYMGTCGRCLVMSRSNGVEEGPRVIETETIASRSSVLATSSRAISLTSSWVSGGMIRIDSALENRRSMWSSRRKALPFQTWKVVGVASEVGGPWSKIEIRASDGGTKAPSIQAAPPASGLAGSSSGSEGVIGSRPVSWVGTISEVSAEKA

Sequence 8(SEQ ID NO:8)

GCAGCAGCCATCACCATCATCACCACAGCCAGGATCCGGTACTGTACCGGGGTCAGCAGAGAAGAAGATTCAACGTTCAGTTCCCAGTAACGACGGATGATAGACTGGGTAACCGGACCCGGAACACCGTCAGAGATCGGGTTACCGTCAACAGAAACGAACGGCCAAACACCACCACCGGTTGAGCAACCCAGAACTTCGTCAGCGTCCAGCAGTTCAGCCAGGGTGATGTCAGCCAGGATAGCTTCGTGACCCAGAGATTCAGCGATTTCCAGAACGGTTTTACGGGTGATACCCGGCAGAGCAGCACGACCCGGAGAACGAACAACACCGTCTTTGATAACAACAACGTTGAAACCCGGACCTTCAGCCAGCAGACCGTCGCAGTCCAGCAGCAGCGGCAGCTCGAAACCACGGTCGTGGGTTTCCTGAATTGCACGGATCAGGTCACCCCACTGGAAGTTTTTAACCTGCGGGTCGATAGAAGAACGCGGAGTACGACGAACAGACTGAGCAACCATAGCGTGAACACCGTCACGGATGCGGTCAAACGGTACGATCCACTGGTACGGAACAGCGTACATGTAAACCTGCGGACGATGTTTGGTGATGTCACGCTCGAATGGGGTAGAAGAGTAACCACGGGTGATAGAAACAGAAACGATTGCTTCACGCAGTTCGGTTTTAGCAACCAGTTCCAGAGCGATCTCTTTAACTTCGTCCTGGGTCAGCGGCGGGATGATACGGATAGATTCCGCGTTAGAGAACAGACGTTCGATGTGGTCGTCCAGACGGAAAGCGTTACCGTTCCAAACGTGGAAGGTGGTGTAGGTAGCGTCAGAAGTATAGTAACCCTGGTCGAAGATAGAGATACGAGCTTCAGACGGCGGAACGAAAGCACCTTCGATCCAAGCAGCACCACCAGCCAGCGGGTTAGCCGGGTCCAGTTCGTAGTCAGAGTAGGTGATATAGTCCAGACCGGTGTCGTGGGTGTAAACGATTTCAGAGGTGTCAGCTGAGAAAGCCAT

Detailed Description

The invention will now be described with reference to the following examples, which are intended to illustrate the invention, but not to limit it.

Unless otherwise indicated, the molecular biology experimental procedures used in the present invention are essentially as described in j.sambrook et al, molecular cloning: a laboratory manual, 2 nd edition, cold spring harbor laboratory Press, 1989, and F.M. Ausubel et al, eds. molecular biology laboratory Manual, 3 rd edition, John Wiley & Sons, Inc., 1995; the detection methods used are all conventional in the art, following the procedures described in the relevant literature or following the procedures recommended by the manufacturer of the instrument used.

EXAMPLE 1 expression of Arthrobacter transaminase mutant proteins

Artificially designing wild sequence of arthrobacter transaminase, wherein the designed gene sequence is shown as SEQ ID 2,4, 6 and 8, synthesizing all the sequences through whole genes, cloning the sequences into PET24a plasmid through Xhol and Ncol 2 enzyme cutting sites, transferring the plasmid constructed above into escherichia coli DH5 alpha competent cells, selecting positive transformants, sequencing and identifying to obtain a recombinant expression vector which is named as 00-8 plasmid (shown in figure 1 and figure 2). The recombinant expression vector 00-8 plasmid is transferred into a bacillus coli BL21(DE3) strain to obtain the genetic engineering bacteria capable of inducing and expressing the arthrobacter transaminase mutant.

Streaking genetically engineered bacteria for expressing arthrobacter transaminase mutants on a kanamycin-resistant LB solid culture medium, culturing overnight in a 37 ℃ biochemical incubator, selecting larger colonies, inoculating the colonies into a kanamycin-resistant LB liquid culture medium, and culturing for 6-8 h at 37 ℃ and 220rpm of a shaking table or overnight at 30 ℃ and 200rpm to obtain a primary seed culture solution; inoculating the primary seed culture solution into a TB liquid culture medium containing kanamycin resistance according to the inoculation amount of 1%, and culturing for 4-6 h at 37 ℃ and 220rpm of a shaking table until the visual bacterial solution is cloudy, thereby obtaining a secondary seed culture solution. The secondary seeds were inoculated into a fermenter at an inoculum size of 1% for cultivation (the culture broth of the secondary seeds was inoculated into the fermenter in three groups according to the medium formulation in Table 2). Initial control: and (3) ventilating and maintaining pressure at 37 ℃. When the dissolved oxygen is reduced, the ventilation volume, the rotating speed and the tank pressure are gradually increased to increase the dissolved oxygen, and the tank pressure is not higher than 0.08 MPa. During fermentation, nutrition is supplemented properlyThe feed (feeding scheme shown in Table 3) was adjusted to control dissolved oxygen at 20-40%, and when OD600 reached about 25, the temperature was lowered to 28 ℃, 30 ℃ and 25 ℃ respectively, and IPTG was added at concentrations of 0.15mM, 0.2mM and 0.3 mM. Collecting thallus from fermentation liquor by centrifugation or membrane filtration, washing the collected thallus with phosphate buffer solution, placing the washed thallus in an ultrasonic crusher or a high-pressure homogenizer for cell disruption, centrifuging or membrane filtering the cell disruption solution to obtain supernatant, i.e. arthrobacter transaminase mutant protein, thereby obtaining mutant 1, dissolving the mutant 1 in pH8.0 KH according to 10-20% of mass concentration2PO4The buffer solution is ready for use.

TABLE 2 recipe of medium in fermenter (demonstrated in 30L fermentation broth, unit: g)

Serial number Name of the ingredient First group Second group Third group
1 Dipotassium hydrogen phosphate 194 294 294
2 Potassium dihydrogen phosphate 30 33 30
3 Ammonium sulfate 25 25 25
4 Anhydrous magnesium sulfate 17.2 17.2 17.2
5 Citric acid 160 160 160
6 Glycerol 50 50 150
7 Fish peptone 140 440 540
8 Yeast extract powder 360 160 360
9 Sodium chloride 15 15 15
10 Manganese chloride tetrahydrate 0.6 2 1.6
11 Ferric chloride 0.6 0.6 1.6
12 Defoaming agent 15 15 15

Note: weighing the raw materials, adding the raw materials into a fermentation tank, adding water to an appropriate volume, stirring, fully mixing, dissolving, and adjusting the pH value to 7 by using caustic soda flakes.

TABLE 3 feed medium formulation (demonstrated with 30L broth feed 6L, unit: g)

Mutants 2-4 were obtained according to the method described above.

Example 2 testing of the enzymatic Activity of the mutants

The enzyme activity detection method comprises the following steps:

(1) prepare 100mL of 4M isopropylamine hydrochloride: 23.64 g of 100% isopropylamine is weighed, about 40mL of water is added, HCl (about 30mL, which is a heavy fogging solution) is slowly added dropwise in a fume hood at low temperature until the pH is 8.5, and finally water is added to the solution until the volume is 100mL for later use.

(2) Preparing an isopropylamine aqueous solution with the mass fraction of 40%.

(3) Preparing a substrate solution: a substrate solution is prepared by dissolving a substrate 3-oxo-4- (2,4, 5-trifluorophenyl) butyrylpiperazine in 200mL of ethanol per 100g, and the prepared substrate solution is filled into a flow-through bottle and kept at 45 ℃ for later use.

(4) Water 600mL (1000 mL total volume of mutant solution from example 1), 4M isopropylamine hydrochloride (1.2eq, 99.4mL), TEA (3g) and pyridoxal coenzyme phosphate (0.7g) were added, the temperature was raised to 45 ℃ and the pH was adjusted to 8.5 with 40% isopropylamine. Mutant solution (400mL) was added and air was added (controlled foaming). The substrate solution (total about 270mL) was fed to the reaction system at a relatively constant rate over a period of 5h to 7 h. The reaction was carried out at 45 ℃ for 12 hours, during which time the pH was controlled at 8.5 with 40% isopropylamine. If the liquid level is lowered, adding proper amount of pure water. The product was extracted with ethyl acetate, the ethyl acetate phase was collected and concentrated, and the residue obtained from the concentration was qualitatively and quantitatively determined by HPLC. The catalytic activity of mutants 1-4 was evaluated by taking the substrate conversion rate as the enzyme activity index, and the results are shown in the following table.

Enzyme activity comparison table

Example 3 Synthesis of sitagliptin

2,4, 5-trifluoro-phenylacetic acid, Meldrum's acid and NHR1R2And 3-trifluoromethyl-5, 6,7, 8-tetrahydro- [1,2,4]Triazolo [4,3-a]Pyrazine hydrochloride is used as a raw material to prepare a transamination substrate beta-carbonyl amide compound I, then the obtained arthrobacter transaminase mutant is used for catalyzing the carbonyl transamination reaction to obtain a beta-amino amide compound II with high optical purity, and then the beta-amino amide compound II is hydrolyzed, subjected to amino protection and subjected to 3-trifluoromethyl-5, 6,7, 8-tetrahydro- [1,2,4]]Triazolo [4,3-a]The sitagliptin is prepared with high yield by condensing and deprotecting pyrazine hydrochloride. The specific synthetic route is as follows:

1. synthesis of Compound 3:

condition 1:

190 g of 2,4, 5-trifluorophenylacetic acid and 210 g of Meldrum's acid are added into 800 ml of diethylacetamide, the temperature is raised to 35 ℃, 50g of triethylamine is added, after the reaction is kept for 5 hours, the temperature is lowered to room temperature, 2000 ml of water is added, hydrochloric acid is used for acidification until the pH value is 2, the mixture is crystallized for 2 hours, then filtration is carried out, and 303 g of compound 3 dry product is obtained after drying, the purity is 99.2%, and the yield is 96%.

Condition 2;

adding 220 g of 2,4, 5-trifluoro-phenylacetic acid and 260 g of Meldrum's acid into 782 ml of dimethylformamide, heating to 35 ℃, adding 61 g of triethylamine, reacting for 4-7 hours under the condition of heat preservation, cooling to room temperature, adding 2500 ml of water, adding 89 g of pivaloyl chloride, crystallizing for 2 hours, filtering, and drying to obtain 348 g of a dry product of the compound 3, wherein the purity is 99.1% and the yield is 95%.

2. Synthesis of Compound I:

condition 1 wherein R in Compound I1And R2The imidazole ring is formed, at which time the structure of the compound of formula I is as follows:

adding 30 g of compound 3 into 300ml of toluene, adding 12 g of imidazole and 0.3 g of sodium hydroxide, heating to 105 ℃, reacting for 10 minutes, cooling to room temperature, crystallizing to obtain a crude product, washing and drying a solid to obtain 25.3 g of 3-oxo-4- (2,4, 5-trifluorophenyl) butyrylimidazole, wherein the purity is 99.5 percent, and the yield is 94 percent.

1HNMR(d6-DMSO)δ(ppm,)8.26(1H),7.69(1H),7.25(1H),6.73(1H),6.54(1H),3.71(2H),3.56(2H).

Condition 2 wherein R in Compound I1And R2To form a piperazine ring, the structure of the compound of formula I is shown here:

to 400ml of tetralin, 35 g of compound 3 was added, 17 g of piperazine was added, the temperature was raised to 100 ℃, 0.25 g of sodium hydroxide was added, the reaction was carried out for 20 minutes, the temperature was lowered to room temperature to obtain a crude solid, and the crude solid was washed with water and dried to obtain 31.7 g of 3-oxo-4- (2,4, 5-trifluorophenyl) butyryl piperazine with a purity of 99.4% and a yield of 95%.

1HNMR(d6-DMSO)δ(ppm,)6.73(1H),6.54(1H),3.71(2H),3.34(2H),3.32(4H),2.81(4H),2.0(1H).

Condition 3 wherein R in Compound I1And R2Forming an isoxazolidine ring, at which time the compound of formula I has the structure shown below:

adding 32 g of compound 3 into 500 ml of toluene, adding 25 g of 4-hydroisoxazole hydrochloride, heating to 101 ℃, adding 40 g of sodium hydroxide, reacting for 30 minutes, cooling to room temperature, filtering, and washing with water to obtain 28 g of 3-oxo-4- (2,4, 5-trifluorophenyl) butyryl-4-hydroisoxazole with the purity of 99.4 percent and the yield of 96 percent.

1HNMR(d6-DMSO)δ(ppm,)6.73(1H),6.54(1H),3.71(2H),3.53(2H),3.34(2H),3.20(2H),1.74(2H).

Condition 4 whereinIn the compound I R1And R2The morpholine ring is formed, at which time the compound of formula I has the structure shown below:

adding 30 g of compound 3 into 90ml of benzene and 200ml of tetralin, adding 14 g of morpholine and 0.25 g of sodium hydroxide, heating to 102 ℃, reacting for 30 minutes, cooling to room temperature to precipitate a crude crystal, washing with water and drying to obtain 27.1 g of 3-oxo-4- (2,4, 5-trifluorophenyl) butyryl morpholine with the purity of 99.4 percent and the yield of 95 percent.1HNMR is shown in FIG. 3.

3. Synthesis of Compound II:

condition 1:

100ml of 4M isopropylamine hydrochloride, 2g of TEA, and 0.1g of pyridoxal phosphate were added to 1000ml of water, warmed to 45 ℃ and adjusted to pH 8.5 with 40% aqueous isopropylamine solution. 600ml of the mutant 1 solution prepared in example 1 was added, and an appropriate amount of air was blown (foaming was controlled). The compound 3-oxo-4- (2,4, 5-trifluorophenyl) butyryl-4-hydroisoxazole solution (150 g of 3-oxo-4- (2,4, 5-trifluorophenyl) butyryl-4-hydroisoxazole dissolved in 40ml of methanol) is fed to the reaction system at a relatively constant speed and is fed over for 5h-7 h. During which time the pH was controlled with 40% isopropylamine. After the reaction is carried out at 45 ℃ for 12 hours, HPLC shows that the conversion rate is more than 99.9 percent, 200ml of dichloromethane is used for extraction after the reaction is finished, and the dichloromethane is recovered to obtain 142.5 g of R-3-amino-4- (2,4, 5-trifluorophenyl) butyryl-4-hydroisoxazole with the purity of 99.7 percent and the yield of 95 percent.

1HNMR(d6-DMSO)δ(ppm,)6.79(1H),6.61(1H),3.32(4H),3.23(1H),2.81(4H),2.77(2H),2.40(2H),2.0(1H),2.0(2H).

With reference to the above reaction conditions, the polypeptide sequence disclosed in Codeixs patent US8293507, SEQ ID NO: 86 as a catalyst catalyzed the above reaction, with HPLC showing 22.1% conversion.

Condition 2:

in 1000ml of water, 90ml of 4M isopropylamine hydrochloride, 1g of TEA, and 0.5g of pyridoxal phosphate were added, warmed to 40 ℃ and adjusted to pH8.0 with 40% aqueous isopropylamine solution. 1100ml of the mutant 1 solution prepared in example 1 was added, and an appropriate amount of air was blown (bubbling was controlled). The compound 3-oxo-4- (2,4, 5-trifluorophenyl) butyryl-piperazine solution (3-oxo-4- (2,4, 5-trifluorophenyl) butyryl-piperazine 250g dissolved in 80 ml ethanol) was fed to the reaction system at a relatively constant rate for 5h to 7 h. During which time the pH was controlled with 40% isopropylamine. After the reaction is carried out at 40 ℃ for 12 hours, HPLC shows that the conversion rate is more than 99.9 percent, and after the reaction is finished, 350 ml of ethyl acetate is used for extraction, and the ethyl acetate is recovered to obtain 240 g of R-3-amino-4- (2,4, 5-trifluorophenyl) butyryl piperazine with the purity of 99.8 percent and the yield of 96 percent.

1HNMR(d6-DMSO)δ(ppm,)6.79(1H),6.61(1H),3.32(2H),3.23(1H),3.34(2H),3.20(2H),1.74(2H).

With reference to the above reaction conditions, the polypeptide sequence disclosed in Codeixs patent US8293507, SEQ ID NO: 86 as a catalyst catalyzed the above reaction, with HPLC showing 12% conversion.

Condition 3:

to 325ml of water were added 95ml of 4M isopropylamine hydrochloride, 1.9g of TEA, and 0.2g of pyridoxal phosphate, the temperature was raised to 45 ℃ and the pH was adjusted to 8.5 with 40% aqueous isopropylamine solution. 625ml of the mutant 1 solution prepared in example 1 was added and an appropriate amount of air was blown in (controlled foaming). The compound 3-oxo-4- (2,4, 5-trifluorophenyl) butyryl-4-morpholine solution (160 g of 3-oxo-4- (2,4, 5-trifluorophenyl) butyryl-4-morpholine dissolved in 45 ml of methanol) was fed to the reaction system at a relatively constant rate for 5h-7 h. During which time the pH was controlled with 40% isopropylamine. After the reaction was carried out at 45 ℃ for 12 hours, HPLC showed that the conversion was more than 99.9%, and after completion, 200ml of dichloromethane was used for extraction, and dichloromethane was recovered to obtain 154 g of R-3-amino-4- (2,4, 5-trifluorophenyl) butyryl-4-morpholine, which had a purity of 99.4% and a yield of 96.3%.

1HNMR(d6-DMSO)δ(ppm,)6.79(1H),6.61(1H),3.67(4H),3.47(4H),3.23(1H),2.77(2H),2.40(2H),2.0(2H).

Condition 4:

100ml of 4M isopropylamine hydrochloride, 2g of TEA, and 0.1g of pyridoxal phosphate were added to 400ml of water, warmed to 45 ℃ and adjusted to pH 8.5 with 40% aqueous isopropylamine solution. 600ml of mutant 1 solution was added and an appropriate amount of air was added (controlled foaming). The compound 3-oxo-4- (2,4, 5-trifluorophenyl) butyryl-4-hydroisoxazole solution (150 g of 3-oxo-4- (2,4, 5-trifluorophenyl) butyryl-4-hydroisoxazole dissolved in 40ml of methanol) is fed to the reaction system at a relatively constant speed and is fed over for 5h-7 h. During which time the pH was controlled with 40% isopropylamine. After the reaction is carried out at 45 ℃ for 12 hours, HPLC shows that the conversion rate is more than 99.9 percent, 200ml of dichloromethane is used for extraction after the reaction is finished, and the dichloromethane is recovered to obtain 144.5 g of R-3-amino-4- (2,4, 5-trifluorophenyl) butyryl-4-hydroisoxazolidine, the purity is 99.8 percent, and the yield is 96.3 percent.

1HNMR(d6-DMSO)δ(ppm,)6.79(1H),6.61(1H),3.32(4H),3.23(1H),2.81(4H),2.77(2H),2.40(2H),2.0(1H),2.0(2H).

With reference to the above reaction conditions, the polypeptide sequence disclosed in Codeixs patent US8293507, SEQ ID NO: 86 as a catalyst catalyzed the above reaction, with HPLC showing 18% conversion.

Condition 5:

in 300ml of water, 90ml of 4M isopropylamine hydrochloride, 1g of TEA, and 0.5g of pyridoxal phosphate were added, warmed to 40 ℃ and adjusted to pH8.0 with 40% aqueous isopropylamine solution. 750ml of the mutant 1 solution prepared in example 1 was added, and an appropriate amount of air was blown (bubbling was controlled). The compound 3-oxo-4- (2,4, 5-trifluorophenyl) butyryl-piperazine solution (3-oxo-4- (2,4, 5-trifluorophenyl) butyryl-piperazine 250g dissolved in 80 ml methanol) was fed to the reaction system at a relatively constant rate for 5h to 7 h. During which time the pH was controlled with 40% isopropylamine. After the reaction is carried out at 40 ℃ for 12 hours, HPLC shows that the conversion rate is more than 99.9 percent, and after the reaction is finished, 350 ml of ethyl acetate is used for extraction, and the ethyl acetate is recovered to obtain 242 g of R-3-amino-4- (2,4, 5-trifluorophenyl) butyryl piperazine with the purity of 99.6 percent and the yield of 96.8 percent.

1HNMR(d6-DMSO)δ(ppm,)6.79(1H),6.61(1H),3.32(2H),3.23(1H),3.34(2H),3.20(2H),1.74(2H).

With reference to the above reaction conditions, the polypeptide sequence disclosed in Codeixs patent US8293507, SEQ ID NO: 86 as a catalyst catalyzed the above reaction, with HPLC showing 13% conversion.

4. Synthesis of compound IV:

condition 1:

adding 80 g of R-3-amino-4- (2,4, 5-trifluorophenyl) butyryl-4-hydroisoxazole into 500 ml of water, adding 27 g of sodium hydroxide, heating to 50 ℃ for reaction for 2 hours, cooling to room temperature, adding 91 g of Boc anhydride, reacting at room temperature for 4-5 hours, acidifying to pH 1.5 by hydrochloric acid after the reaction is finished, crystallizing, filtering, washing with water, and drying to obtain 88.8 g of the product with the yield of 96% and the chemical purity of 99.5%. Product of1The HNMR map is shown in FIG. 4.

Condition 2:

30 g of R-3-amino-4- (2,4, 5-trifluorophenyl) butyryl piperazine and 10 g of sodium hydroxide are added into 350 ml of water, the temperature is raised to 60 ℃ for reaction for 3 hours, the temperature is lowered to room temperature, 43 g of Boc anhydride is added, the reaction is carried out at room temperature for 6 hours, after the reaction is finished, hydrochloric acid is used for acidification until the pH value is 1.7, crystals are filtered, washed by water and dried to obtain 31.5 g, the yield is 95%, and the chemical purity is 99.4%. Product of1The HNMR map is shown in FIG. 5.

Condition 3:

30 g of R-3-amino-4- (2,4, 5-trifluorophenyl) butyryl morpholine is added into 350 ml of water, 8 g of sodium hydroxide is added, the temperature is raised to 58 ℃ for 2.5 hours, the temperature is lowered to room temperature, 46 g of Boc anhydride is added, the reaction is carried out at the room temperature for 5 hours, after the reaction is finished, hydrochloric acid is used for acidification until the pH value is 1.7, crystals are filtered, washed by water and dried, and 31.8 g is obtained, the yield is 96 percent, and the chemical purity is 99.5 percent. Product of1The HNMR map is shown in FIG. 6.

5. Synthesis of sitagliptin:

condition 1:

adding 30 g of compound IV into 300ml of dichloromethane, cooling to 15 ℃, adding 26.8 g of thionyl chloride, heating to 25 ℃, reacting for 2 hours, adding 20 g of triethylamine, adding 22.7 g of 3- (trifluoromethyl) -5,6,7, 8-tetrahydro- [1,2,4] triazolo [4,3-a ] pyrazine hydrochloride, reacting for 5-6 hours at 25 ℃, adding 100ml of water after the reaction is finished, layering, and concentrating and crystallizing an organic layer to obtain 34.8 g of sitagliptin dry product with the purity of 99.8%, the chiral purity of 99.9% and the yield of 95%. The HPLC spectra of chemical purity and chiral purity of the product are shown in fig. 7 and fig. 8, respectively.

Condition 2:

adding 30 g of compound V into 250 ml of ethyl acetate, cooling to 15 ℃, adding 28 g of thionyl chloride, heating to 26 ℃, reacting for 2 hours, adding 23 g of triethylamine, adding 223 g of 3- (trifluoromethyl) -5,6,7, 8-tetrahydro- [1,2,4] triazolo [4,3-a ] pyrazine hydrochloride, reacting for 5 to 6 hours at the temperature of 25 ℃, adding 200ml of water after the reaction is finished, layering, concentrating and crystallizing an organic layer to obtain 35.2 g of a sitagliptin dry product, wherein the purity is 99.9%, the chiral purity is 100%, and the yield is 96%. The HPLC spectra of chemical purity and chiral purity of the product are shown in fig. 9 and fig. 10, respectively.

The chiral purity detection method comprises the following steps:

a chromatographic column: CHIRALPAK AD-H4.6 mm x 250mm,5 um;

wavelength: 210 nm;

column temperature: 40 ℃;

flow rate: 1.0 mL/min;

sample introduction amount: 20 uL;

mobile phase: n-hexane: ethanol: isopropyl alcohol: diethylamine 400: 500: 100: 3;

diluent agent: methanol: mobile phase 50:50 (treating the sample with diluent while blanking with diluent);

the chemical purity detection method comprises the following steps:

a chromatographic column: kromasil 100-5-C184.6mm x 250mm,5 um;

flow rate: 1.0 ml/min;

wavelength: 210 nm;

sample introduction amount: 20 ul;

column temperature: 30 ℃;

preparing a buffer solution:

9.6g of citric acid are adjusted to pH 4 in 1L of water with 5% sodium hydroxide and are ready for use.

Preparation of mobile phase A: buffer solution: mixing methanol at 800:200, filtering, and aerating for use.

Preparation of mobile phase B: methanol: tetrahydrofuran 900: 100, mixing, filtering and aerating for later use.

Preparing a diluent: methanol: 50:50 of water.

The procedure is as follows:

time (min) A% B%
0 90 10
15 60 40
20 90 10
50 90 10

While specific embodiments of the invention have been described in detail, it will be appreciated by those skilled in the art that various modifications and alternatives to those details could be developed in light of the overall teachings of the disclosure, and that such modifications are intended to be included within the scope of the disclosure. The full scope of the invention is given by the appended claims and any equivalents thereof.

SEQUENCE LISTING

<110> Beijing Fusheng Jiahua medicine science and technology Co., Ltd

NANJING REDWOOD FINE CHEMICAL Co.,Ltd.

<120> method for synthesizing sitagliptin and intermediate thereof by biocatalysis

<130> IDC200474

<150> 201810442572.3

<151> 2018-05-10

<160> 8

<170> PatentIn version 3.5

<210> 1

<211> 343

<212> PRT

<213> artificial

<220>

<223> amino acid sequence of Arthrobacter-derived transaminase mutant 1

<400> 1

Ser Val Leu His Arg Gly Gln Gln Arg Arg Arg Phe His Ile Gln Phe

1 5 10 15

Pro Val Thr Thr Asp Asn Ala Leu Gly Asn Arg Thr Arg His Thr Val

20 25 30

Arg Asn Gly Ile Thr Ile Asp Arg Asn Glu Arg Pro Asp Ala Thr Ala

35 40 45

Gly Gly Ala Thr Gln Asn Phe Val Ser Ile Val Gln Phe Cys Arg Arg

50 55 60

Asp Ile Gly Gln Asn Arg Phe Val Ala Gln Arg Phe Arg Asp Phe Gln

65 70 75 80

Asn Gly Leu Ala Arg Asn Thr Arg Gln Ser Cys Thr Thr Arg Ala Thr

85 90 95

Asn His Thr Ile Phe Asp Asp Asn His Ile Lys Ala Arg Thr Phe Ser

100 105 110

Gln Gln Val Val Thr Ile Gln Gln Gln Arg Gln Phe Glu Thr Ala Ile

115 120 125

Met Gly Phe Leu Asp Cys Thr Asn Gln Val Ala Pro Leu Lys Val Leu

130 135 140

His Leu Arg Ile Asn Gly Thr Thr Arg Gly Ala Thr Asp Ala Leu Cys

145 150 155 160

Asn His Gln Val His Thr Val Ala Asp Thr Ile Glu Arg Asn Asn Pro

165 170 175

Leu Val Arg Ala Arg Thr His Ile His Leu Arg Ala Met Phe Gly Asp

180 185 190

Ile Thr Phe Lys Arg Arg Arg Ala Ile Ala Ala Gly Asn Arg His Gly

195 200 205

Asp His Gly Phe Thr Gln Phe Gly Leu Gly His Gln Phe Gln Arg Asp

210 215 220

Phe Phe Asp Phe Ile Leu Arg Gln Arg Arg Asp Gln Ala Asn Arg Phe

225 230 235 240

Cys Ile Ala Glu Gln Ala Phe Asn Val Val Ala Gln Thr Glu Ser Ile

245 250 255

Thr Val Pro Asn Met Lys Arg Gly Val Gly Cys Val Arg Arg Ile Glu

260 265 270

Thr Leu Ile Lys Asp Gly Asn Thr Gly Phe Thr Arg Arg His Lys Arg

275 280 285

Thr Leu Asn Pro Cys Cys Thr Ala Ser Gln Arg Val Cys Arg Val Gln

290 295 300

Phe Val Val Ala Val Gly Asn Val Val Gln Ala Arg Ile Val Gly Val

305 310 315 320

Asn Asn Phe Arg Arg Val Cys Gly Glu Cys His Arg Ile Leu Ala Val

325 330 335

Val Met Met Val Met Ala Ala

340

<210> 2

<211> 972

<212> DNA

<213> artificial

<220>

<223> Gene sequence of Arthrobacter-derived transaminase mutant 1

<400> 2

atggcctcta tggacaaagt cttttcggga tattatgcgc gccagaagct gcttgaacgg 60

agcgacaatc ctttctctaa gggcattgct tatgtggaag gaaagctcgt ctttcctagt 120

gatgctagaa taccgctact cgacgaaggt ttcatgcaca gtgacctaac ctatgatgtt 180

atatcggttt gggatggtcg cttctttcga ttggacgatc atttgcaacg gattttggaa 240

agctgcgata agatgcggct caagttccca cttgcactga gcaccgtgga aaatattctg 300

gctgagatgg tcgccaagag tggtatccgg gatgcgtttg tggaagttat tgtgacacgt 360

ggtctgacag gtgtacgtgg ttcgaagcct gaggatctgt ataataacaa catatacctg 420

cttgttcttc catacatttg ggttatggcg cctgagaacc agctccatgg tggcgaggct 480

atcattacaa ggacagtgcg acgaacaccc ccaggtgcat ttgatcctac tatcaaaaat 540

ctacagtggg gtgatttaac aaagggactt tttgaggcaa tggaccgtgg cgccacatac 600

ccatttctca ctgatggaga caccaacctt actgaaggat ctggtttcaa cattgttttg 660

gtgaagaacg gtattatcta tacccctgat cgaggtgtct tgcgagggat cacacgtaaa 720

agtgtgattg acgttgcccg agccaacagc atcgacatcc gccttgaggt cgtaccagtg 780

gagcaggctt atcactctga tgagatcttc atgtgcacaa ctgccggcgg cattatgcct 840

ataacattgc ttgatggtca acctgttaat gacggccagg ttggcccaat cacaaagaag 900

atatgggatg gctattggga gatgcactac aatccggcgt atagttttcc tgttgactat 960

ggcagtggct aa 972

<210> 3

<211> 322

<212> PRT

<213> artificial

<220>

<223> amino acid sequence of Arthrobacter-derived transaminase mutant 2

<400> 3

Ala Ala Ala Ile Thr Ile Ile Thr Thr Ala Arg Ile Arg Tyr Cys Thr

1 5 10 15

Gly Val Ser Arg Glu Glu Asp Ser Thr Phe Ser Ser Gln Gly Arg Arg

20 25 30

Met Ile Asp Trp Val Thr Gly Pro Gly Thr Pro Ser Glu Ile Gly Leu

35 40 45

Pro Ser Thr Glu Thr Asn Gly Gln Thr Pro Pro Pro Val Val Gln Pro

50 55 60

Arg Thr Ser Ser Ala Ser Ser Ser Ser Ala Arg Val Met Ser Ala Arg

65 70 75 80

Ile Ala Ser Gly Pro Arg Asp Ser Ala Ile Ser Arg Thr Val Leu Arg

85 90 95

Val Ile Pro Gly Arg Ala Ala Ala Ser Arg Pro Ser Pro Ser Ser Ser

100 105 110

Ser Gly Ala Ser Lys Pro Arg Ser Trp Val Ser Gly Thr Ala Arg Ile

115 120 125

Arg Ser Pro His Trp Lys Phe Leu Thr Cys Gly Ser Ile Glu Glu Arg

130 135 140

Gly Val Arg Arg Thr Asp Gly Ala Thr Ile Ala Gly Thr Pro Ser Arg

145 150 155 160

Met Arg Ser Asn Gly Thr Ile His Trp Tyr Gly Thr Ala Tyr Met Gly

165 170 175

Thr Cys Gly Arg Cys Leu Val Met Ser Arg Ser Pro Gly Val Glu Glu

180 185 190

Gly Pro Arg Val Ile Glu Thr Glu Thr Thr Ala Ser Arg Ser Ser Val

195 200 205

Leu Ala Thr Ser Ser Arg Ala Ile Ser Leu Thr Ser Ser Trp Val Ser

210 215 220

Gly Gly Met Ile Arg Ile Asp Ser Ala Leu Glu Asn Arg Arg Ser Met

225 230 235 240

Trp Ser Ser Arg Arg Lys Ala Leu Pro Phe Gln Thr Trp Asn Pro Val

245 250 255

Gly Val Thr Ser Glu Cys Arg Gly Pro Trp Ser Lys Ile Glu Ile Arg

260 265 270

Ala Ser Asp Gly Gly Thr Lys Ala Pro Ser Ile Gln Ala Ala Pro Pro

275 280 285

Ala Ser Gly Leu Ala Gly Ser Ser Ser Gly Ser Glu Gly Val Ile Gly

290 295 300

Ser Arg Pro Val Ser Trp Val Gly Thr Ile Ser Glu Val Ser Ala Glu

305 310 315 320

Lys Ala

<210> 4

<211> 968

<212> DNA

<213> artificial

<220>

<223> Gene sequence of Arthrobacter-derived transaminase mutant 2

<400> 4

gcagcagcca tcaccatcat caccacagcc aggatccggt actgtaccgg ggtcagcaga 60

gaagaagatt caacgttcag ttcccagtaa cgacggatga tagactgggt aaccggaccc 120

ggaacaccgt cagagatcgg gttaccgtca acagaaacga acggccaaac accaccaccg 180

gtagtgcaac ccagaacttc gtcagcgtcc agcagttcag ccagggtgat gtcagccagg 240

atagcttcgt gacccagaga ttcagcgatt tccagaacgg ttttacgggt gatacccggc 300

agagcagcag ccagcagacc gtcaccgtcc agcagcagcg gagcttcgaa accacggtcg 360

tgggtttcct gaactgcacg gatcaggtca ccccactgga agtttttaac ctgcgggtcg 420

atagaagaac gcggagtacg acgaacagac tgagcaacca tagcgtgaac accgtcacgg 480

atgcggtcaa acggtacgat ccactggtac ggaacagcgt acatgtaaac ctgcggacga 540

tgtttggtga tgtcacgttc acctggggta gaagagtaac cacgggtgat agaaacagaa 600

acgactgctt cacgcagttc ggttttagca accagttcca gagcgatttc tttaacttcg 660

tcctgggtca gcggcgggat gatacgcata gattcagcgt tagagaacag acgttcgatg 720

tggtcgtcca gacggaaagc gttaccgttc caaacgtgga acccggtgta ggtaacgtca 780

gagtgcaggt aaccctggtc gaagatagag atacgagctt cagacggcgg aacgaaagca 840

ccttcgatcc aagcagcacc accagccagc gggttagccg ggtccagttc gtagtcagag 900

taggtgatat agtccagacc ggtgtcgtgg gtgtaaacga tttcagaggt gtcagcagag 960

aaagccat 968

<210> 5

<211> 342

<212> PRT

<213> artificial

<220>

<223> amino acid sequence of Arthrobacter-derived transaminase mutant 3

<400> 5

Ala Ala Ala Ile Thr Ile Ile Thr Thr Ala Arg Ile Arg Tyr Cys Thr

1 5 10 15

Gly Val Ser Arg Glu Glu Asp Ser Thr Phe Ser Ser Gln Gly Arg Arg

20 25 30

Met Ile Asp Trp Val Thr Gly Pro Gly Thr Pro Ser Glu Ile Gly Leu

35 40 45

Pro Ser Thr Glu Thr Asn Gly Gln Thr Pro Pro Pro Val Glu Gln Pro

50 55 60

Arg Thr Ser Ser Ala Ser Ser Ser Ser Ala Arg Val Met Ser Ala Arg

65 70 75 80

Ile Ala Ser Gly Pro Arg Asp Ser Ala Ile Ser Arg Thr Val Leu Arg

85 90 95

Val Ile Pro Gly Arg Ala Ala Arg Pro Gly Glu Arg Thr Thr Pro Ser

100 105 110

Leu Ile Thr Thr Thr Leu Lys Pro Gly Pro Ser Ala Ser Arg Pro Ser

115 120 125

Pro Ser Ser Ser Ser Gly Ser Ser Lys Pro Arg Ser Trp Val Ser Gly

130 135 140

Ile Ala Arg Ile Arg Ser Pro His Trp Lys Phe Leu Thr Cys Gly Ser

145 150 155 160

Ile Glu Glu Arg Gly Val Arg Arg Thr Asp Gly Ala Thr Ile Ala Gly

165 170 175

Thr Pro Ser Arg Met Arg Ser Asn Gly Thr Ile His Trp Tyr Gly Thr

180 185 190

Ala Tyr Met Gly Thr Cys Gly Arg Cys Leu Val Met Ser Arg Ile Tyr

195 200 205

Gly Val Glu Glu Gly Pro Arg Val Ile Glu Thr Glu Thr Ile Ala Ser

210 215 220

Arg Ser Ser Val Leu Ala Thr Ser Ser Arg Ala Ile Ser Leu Thr Ser

225 230 235 240

Ser Trp Val Ser Gly Gly Met Ile Arg Ile Asp Ser Ala Leu Glu Asn

245 250 255

Arg Arg Ser Met Trp Ser Ser Arg Arg Lys Ala Leu Pro Phe Gln Thr

260 265 270

Trp Asn Pro Val Gly Val Ala Ser Glu Val Arg Gly Pro Trp Ser Lys

275 280 285

Ile Glu Ile Arg Ala Ser Asp Gly Gly Thr Lys Ala Pro Ser Ile Gln

290 295 300

Ala Ala Pro Pro Ala Ser Gly Leu Ala Gly Ser Ser Ser Trp Ser Glu

305 310 315 320

Gly Val Ile Gly Ser Arg Pro Val Ser Trp Val Gly Thr Ile Ser Glu

325 330 335

Val Ser Ala Glu Lys Ala

340

<210> 6

<211> 1028

<212> DNA

<213> artificial

<220>

<223> Gene sequence of Arthrobacter-derived transaminase mutant 3

<400> 6

gcagcagcca tcaccatcat caccacagcc aggatccggt actgtaccgg ggtcagcaga 60

gaagaagatt caacgttcag ttcccagtaa cgacggatga tagactgggt aaccggaccc 120

ggaacaccgt cagagatcgg gttaccgtca acagaaacga acggccaaac accaccaccg 180

gttgagcaac ccagaacttc gtcagcgtcc agcagttcag ccagggtgat gtcagccagg 240

atagcttcgt gacccagaga ttcagcgatt tccagaacgg ttttacgggt gatacccggc 300

agagcagcac gacccggaga acgaacaaca ccgtctttga taacaacaac gttgaaaccc 360

ggaccttcag ccagcagacc gtcaccgtcc agcagcagcg gcagctcgaa accacggtcg 420

tgggtttcct gaattgcacg gatcaggtca ccccactgga agtttttaac ctgcgggtcg 480

atagaagaac gcggagtacg acgaacagac tgagcaacca tagcgtgaac accgtcacgg 540

atgcggtcaa acggtacgat ccactggtac ggaacagcgt acatgtaaac ctgcggacga 600

tgtttggtga tgtcacgaat atatggggta gaagagtaac cacgggtgat agaaacagaa 660

acgattgctt cacgcagttc ggttttagca accagttcca gagcgatttc tttaacttcg 720

tcctgggtca gcggcgggat gatacgcata gattcagcgt tagagaacag acgttcgatg 780

tggtcgtcca gacggaaagc gttaccgttc caaacgtgga acccggtgta ggtagcgtca 840

gaggtcaggt aaccctggtc gaagatagag atacgagctt cagacggcgg aacgaaagca 900

ccttcgatcc aagcagcacc accagccagc gggttagccg ggtccagttc gtggtcagag 960

taggtgatat agtccagacc ggtgtcgtgg gtgtaaacga tttcagaggt gtcagcagag 1020

aaagccat 1028

<210> 7

<211> 342

<212> PRT

<213> artificial

<220>

<223> amino acid sequence of Arthrobacter-derived transaminase mutant 4

<400> 7

Ala Ala Ala Ile Thr Ile Ile Thr Thr Ala Arg Ile Arg Tyr Cys Thr

1 5 10 15

Gly Val Ser Arg Glu Glu Asp Ser Thr Phe Ser Ser Gln Gly Arg Arg

20 25 30

Met Ile Asp Trp Val Thr Gly Pro Gly Thr Pro Ser Glu Ile Gly Leu

35 40 45

Pro Ser Thr Glu Thr Asn Gly Gln Thr Pro Pro Pro Val Glu Gln Pro

50 55 60

Arg Thr Ser Ser Ala Ser Ser Ser Ser Ala Arg Val Met Ser Ala Arg

65 70 75 80

Ile Ala Ser Gly Pro Arg Asp Ser Ala Ile Ser Arg Thr Val Leu Arg

85 90 95

Val Ile Pro Gly Arg Ala Ala Arg Pro Gly Glu Arg Thr Thr Pro Ser

100 105 110

Leu Ile Thr Thr Thr Leu Lys Pro Gly Pro Ser Ala Ser Arg Pro Ser

115 120 125

Gln Ser Ser Ser Ser Gly Ser Ser Lys Pro Arg Ser Trp Val Ser Gly

130 135 140

Ile Ala Arg Ile Arg Ser Pro His Trp Lys Phe Leu Thr Cys Gly Ser

145 150 155 160

Ile Glu Glu Arg Gly Val Arg Arg Thr Asp Gly Ala Thr Ile Ala Gly

165 170 175

Thr Pro Ser Arg Met Arg Ser Asn Gly Thr Ile His Trp Tyr Gly Thr

180 185 190

Ala Tyr Met Gly Thr Cys Gly Arg Cys Leu Val Met Ser Arg Ser Asn

195 200 205

Gly Val Glu Glu Gly Pro Arg Val Ile Glu Thr Glu Thr Ile Ala Ser

210 215 220

Arg Ser Ser Val Leu Ala Thr Ser Ser Arg Ala Ile Ser Leu Thr Ser

225 230 235 240

Ser Trp Val Ser Gly Gly Met Ile Arg Ile Asp Ser Ala Leu Glu Asn

245 250 255

Arg Arg Ser Met Trp Ser Ser Arg Arg Lys Ala Leu Pro Phe Gln Thr

260 265 270

Trp Lys Val Val Gly Val Ala Ser Glu Val Gly Gly Pro Trp Ser Lys

275 280 285

Ile Glu Ile Arg Ala Ser Asp Gly Gly Thr Lys Ala Pro Ser Ile Gln

290 295 300

Ala Ala Pro Pro Ala Ser Gly Leu Ala Gly Ser Ser Ser Gly Ser Glu

305 310 315 320

Gly Val Ile Gly Ser Arg Pro Val Ser Trp Val Gly Thr Ile Ser Glu

325 330 335

Val Ser Ala Glu Lys Ala

340

<210> 8

<211> 1028

<212> DNA

<213> artificial

<220>

<223> Gene sequence of Arthrobacter-derived transaminase mutant 4

<400> 8

gcagcagcca tcaccatcat caccacagcc aggatccggt actgtaccgg ggtcagcaga 60

gaagaagatt caacgttcag ttcccagtaa cgacggatga tagactgggt aaccggaccc 120

ggaacaccgt cagagatcgg gttaccgtca acagaaacga acggccaaac accaccaccg 180

gttgagcaac ccagaacttc gtcagcgtcc agcagttcag ccagggtgat gtcagccagg 240

atagcttcgt gacccagaga ttcagcgatt tccagaacgg ttttacgggt gatacccggc 300

agagcagcac gacccggaga acgaacaaca ccgtctttga taacaacaac gttgaaaccc 360

ggaccttcag ccagcagacc gtcgcagtcc agcagcagcg gcagctcgaa accacggtcg 420

tgggtttcct gaattgcacg gatcaggtca ccccactgga agtttttaac ctgcgggtcg 480

atagaagaac gcggagtacg acgaacagac tgagcaacca tagcgtgaac accgtcacgg 540

atgcggtcaa acggtacgat ccactggtac ggaacagcgt acatgtaaac ctgcggacga 600

tgtttggtga tgtcacgctc gaatggggta gaagagtaac cacgggtgat agaaacagaa 660

acgattgctt cacgcagttc ggttttagca accagttcca gagcgatctc tttaacttcg 720

tcctgggtca gcggcgggat gatacggata gattccgcgt tagagaacag acgttcgatg 780

tggtcgtcca gacggaaagc gttaccgttc caaacgtgga aggtggtgta ggtagcgtca 840

gaagtatagt aaccctggtc gaagatagag atacgagctt cagacggcgg aacgaaagca 900

ccttcgatcc aagcagcacc accagccagc gggttagccg ggtccagttc gtagtcagag 960

taggtgatat agtccagacc ggtgtcgtgg gtgtaaacga tttcagaggt gtcagctgag 1020

aaagccat 1028

35页详细技术资料下载
上一篇:一种医用注射器针头装配设备
下一篇:HCV抑制剂的盐及其制备方法

网友询问留言

已有0条留言

还没有人留言评论。精彩留言会获得点赞!

精彩留言,会给你点赞!

技术分类