Compounds and methods for modulating adenosine A2B receptor and adenosine A2A receptor

文档序号：1219508 发布日期：2020-09-04 浏览：29次中文

阅读说明：本技术 用于调节腺苷a2b受体和腺苷a2a受体的化合物和方法 (Compounds and methods for modulating adenosine A2B receptor and adenosine A2A receptor ) 是由 Z·李 L·K·菲洛诺娃 E·K·布拉德利 E·弗纳于 2018-08-31 设计创作，主要内容包括：本文尤其公开用于调节腺苷受体的组合物和方法。在一方面中,提供一种抑制腺苷A2B受体活性和腺苷A2A受体活性的方法,所述方法包含使所述腺苷A2B受体和腺苷A2A受体与如包含实施例的本文所描述的化合物接触。(Disclosed herein, inter alia, are compositions and methods for modulating adenosine receptors. In one aspect, there is provided a method of inhibiting adenosine A2B receptor activity and adenosine A2A receptor activity, the method comprising contacting the adenosine A2B receptor and adenosine A2A receptor with a compound as described herein, including the examples.)

1. A compound having the formula:

wherein

L¹Is substituted or unsubstituted C₁-C₃Alkylene or substituted or unsubstituted 2-to 3-membered heteroalkylene;

ring a is aryl or heteroaryl;

R¹independently of one another is halogen, -CX¹ ₃、-CHX¹ ₂、-CH₂X¹、-OCX¹ ₃、-OCH₂X¹、-OCHX¹ ₂、-CN、-SR^1D、-NR^1AR^1B、-C(O)R^1C、-C(O)OR^1C、-C(O)NR^1AR^1B、-OR^1D、-NR^1AC(O)R^1C、-NR^1AC(O)OR^1C、-SO₂R^1D、-SO₂NR^1AR^1B、-NR^1ASO₂R^1DSubstituted or unsubstituted alkyl or substituted or unsubstituted heteroalkyl;

z1 is an integer from 0 to 5;

R²independently is hydrogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;

R³independently is hydrogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;

R²and R³Can optionally join to form a substituted or unsubstituted heterocycloalkyl;

R⁴independently hydrogen, halogen, -CX⁴ ₃、-CHX⁴ ₂、-CH₂X⁴、-OCX⁴ ₃、-OCH₂X⁴、-OCHX⁴ ₂、-CN、-SR^4D、-NR^4AR^4B、-C(O)R^4C、-C(O)OR^4C、-C(O)NR^4AR^4B、-OR^4D、-NR^4AC(O)R^4C、-NR^4AC(O)OR^4CSubstituted or unsubstituted alkyl or substituted or unsubstituted heteroalkyl;

R⁵independently hydrogen, halogen, -CX⁵ ₃、-CHX⁵ ₂、-CH₂X⁵、-OCX⁵ ₃、-OCH₂X⁵、-OCHX⁵ ₂、-CN、-SR^5D、-NR^5AR^5B、-C(O)R^5C、-C(O)OR^5C、-C(O)NR^5AR^5B、-OR^5D、-NR^5AC(O)R^5C、-NR^5AC(O)OR^5CSubstituted or unsubstituted alkyl or substituted or unsubstituted heteroalkyl;

each R^1A、R^1B、R^1C、R^1D、R^4A、R^4B、R^4C、R^4D、R^5A、R^5B、R^5CAnd R^5DIndependently hydrogen, halogen, -CF₃、-CBr₃、-CCl₃、-CI₃、-CHF₂、-CHBr₂、-CHCl₂、-CHI₂、-CH₂F、-CH₂Br、-CH₂Cl、-CH₂I、-OCF₃、-OCBr₃、-OCCl₃、-OCI₃、-OCHF₂、-OCHBr₂、-OCHCl₂、-OCHI₂、-OCH₂F、-OCH₂Br、-OCH₂Cl、-OCH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂、-NHC(O)NH₂、-NHSO₂H. -NHC (O) H, -NHC (O) OH, -NHOH, unsubstituted alkyl, unsubstituted heteroalkyl, unsubstituted cycloalkyl, unsubstituted heterocycloalkyl, unsubstituted aryl or unsubstituted heteroaryl;

with the same nitrogenAtom-bonded R^1BAnd R^1BSubstituents can optionally join to form a substituted or unsubstituted heterocycloalkyl;

r bound to the same nitrogen atom^4BAnd R^4BSubstituents can optionally join to form a substituted or unsubstituted heterocycloalkyl;

r bound to the same nitrogen atom^5BAnd R^5BSubstituents can optionally join to form a substituted or unsubstituted heterocycloalkyl;

each X¹、X⁴And X⁵Independently is-F, -Cl, -Br or-I; and

wherein said compound is not

2. The compound of claim 1, wherein

When R is²And R³R forms unsubstituted heterocycloalkyl and z1 is 0⁴Is not hydrogen;

when R is²Or R³Is hydrogen and L¹When it is an unsubstituted methylene group, R⁴Is not hydrogen; or

When R is²When is hydrogen, R³Is not unsubstituted cyclopropyl.

3. The compound of claim 1, wherein R²Is hydrogen, substituted or unsubstituted C₁-C₆Alkyl, substituted or unsubstituted 2-to 6-membered heteroalkyl, substituted or unsubstituted C₃-C₆Cycloalkyl, substituted or unsubstituted 3-to 6-membered heterocycloalkyl, substituted or unsubstituted phenyl, or substituted or unsubstituted 5-to 6-membered heteroaryl.

4. The compound of claim 1, wherein R²Is substituted or unsubstituted C₁-C₆An alkyl group.

5. The compound of claim 1, wherein R²Is substituted or unsubstituted C₃-C₆A cycloalkyl group.

6. The compound of claim 1, wherein R²Is hydrogen.

7. The compound of claim 1, wherein R³Is hydrogen, substituted or unsubstituted C₁-C₆Alkyl, substituted or unsubstituted 2-to 6-membered heteroalkyl, substituted or unsubstituted C₃-C₆Cycloalkyl, substituted or unsubstituted 3-to 6-membered heterocycloalkyl, substituted or unsubstituted phenyl, or substituted or unsubstituted 5-to 6-membered heteroaryl.

8. The compound of claim 1, wherein R³Is substituted or unsubstituted C₁-C₆An alkyl group.

9. The compound of claim 1, wherein R³Is substituted or unsubstituted C₃-C₆A cycloalkyl group.

10. The compound of claim 1, wherein R³Is hydrogen.

11. The compound of claim 1, wherein R²And R³To form a substituted or unsubstituted heterocycloalkyl.

12. The compound of claim 1, wherein ring a is phenyl or 5-to 6-membered heteroaryl.

13. The compound of claim 1, wherein ring a is phenyl, pyridyl, pyrazolyl, imidazolyl, oxazolyl, isoxazolyl, thiazolyl, furyl, pyrrolyl, thienyl, pyrazinyl, pyridazinyl, or pyrimidinyl.

14. The compound of claim 1, wherein ring a is phenyl or pyridyl.

15. The compound of claim 1, wherein ring a is pyridyl.

16. The compound of claim 1, having the formula:

wherein

W¹Is CH or N.

17. The compound of claim 1, having the formula:

18. the compound of claim 1, having the formula:

19. the compound of claim 1, having the formula:

20. the compound of claim 1, wherein L¹Is substituted or unsubstituted C₁-C₃An alkylene group.

21. The compound of claim 1, wherein L¹Is a substituted or unsubstituted methylene group.

22. The compound of claim 1, wherein R⁴Is hydrogen, halogen, -CX⁴ ₃、-CHX⁴ ₂、-CH₂X⁴、-OCX⁴ ₃、-OCH₂X⁴、-OCHX⁴ ₂、-CN、-SR^4D、-NR^4AR^4BOr substituted or unsubstituted C₁-C₆An alkyl group.

23. The compound of claim 1, wherein R⁴Is hydrogen, halogen, -CX₃、-NR^4AR^4BOr substituted or unsubstituted C₁-C₆An alkyl group.

24. The compound of claim 1, wherein R⁴Is hydrogen, halogen, -CF₃、-NH₂、-NH(CH₃) Or unsubstituted C₁-C₆An alkyl group.

25. The compound of claim 1, wherein R⁴Is hydrogen or unsubstituted methyl.

26. The compound of claim 1, wherein R⁵Is hydrogen, halogen, -CX⁵ ₃、-CHX⁵ ₂、-CH₂X⁵、-OCX⁵ ₃、-OCH₂X⁵、-OCHX⁵ ₂、-CN、-SR^5D、-NR^5AR^5BOr substituted or unsubstituted C₁-C₆An alkyl group.

27. The compound of claim 1, wherein R⁵Is hydrogen, halogen, -CX₃、-NR^5AR^5BOr substituted or unsubstituted C₁-C₆An alkyl group.

28. The compound of claim 1, wherein R⁵Is hydrogen, halogen, -CF₃、-NH₂、-NH(CH₃) Or unsubstituted C₁-C₆An alkyl group.

29. The compound of claim 1, wherein R⁵Is hydrogen or unsubstituted methyl.

30. The compound of claim 1, having the formula:

wherein

Ring B is heterocycloalkyl;

R⁶independently of one another is halogen, -CX⁶ ₃、-CHX⁶ ₂、-CH₂X⁶、-OCX⁶ ₃、-OCH₂X⁶、-OCHX⁶ ₂、-CN、-SR^6D、-SO₂R^6D、-NR^6AR^6B、-C(O)R^6C、-C(O)OR^6C、-C(O)NR^6AR^6B、-C(O)NR^6AOR^6B、-OR^6D、-NR^6AC(O)R^6C、-NR^6AC(O)OR^6CSubstituted or unsubstituted alkyl or substituted or unsubstituted heteroalkyl;

z6 is an integer from 0 to 10;

each R^6A、R^6B、R^6CAnd R^6DIndependently hydrogen, halogen, -CF₃、-CBr₃、-CCl₃、-CI₃、-CHF₂、-CHBr₂、-CHCl₂、-CHI₂、-CH₂F、-CH₂Br、-CH₂Cl、-CH₂I、-OCF₃、-OCBr₃、-OCCl₃、-OCI₃、-OCHF₂、-OCHBr₂、-OCHCl₂、-OCHI₂、-OCH₂F、-OCH₂Br、-OCH₂Cl、-OCH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂、-NHC(O)NH₂、-NHSO₂H. -nhc (o) H, -nhc (o) OH, -NHOH, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;

r bound to the same nitrogen atom^6AAnd R^6BSubstituents can optionally join to form a substituted or unsubstituted heterocycloalkyl; and

X⁶independently is-F, -Cl, -Br or-I.

31. The compound of claim 30, having the formula:

wherein W¹Is CH or N.

32. The compound of claim 30, having the formula:

33. the compound of claim 30, having the formula:

34. the compound of claim 30, having the formula:

35. the compound of claim 30, wherein ring B is 4-to 8-membered heterocycloalkyl.

36. The compound of claim 30, wherein ring B is 4-to 6-membered heterocycloalkyl.

37. The compound of claim 30, wherein ring B is azetidinyl.

38. The compound of claim 30, wherein z6 is 1.

39. The compound of claim 30, wherein R⁶Independently of one another is halogen, -CX⁶ ₃、-CHX⁶ ₂、-CH₂X⁶、-OCX⁶ ₃、-OCH₂X⁶、-OCHX⁶ ₂、-NR^6AR^6B、-C(O)R^6CC substituted or unsubstituted₁-C₆Alkyl or substituted or unsubstituted 2 to 6 membered heteroalkyl.

40. The compound of claim 30, wherein R⁶Independently of one another is halogen, -CX⁶ ₃、-CHX⁶ ₂、-CH₂X⁶、-OCX⁶ ₃、-OCH₂X⁶、-OCHX⁶ ₂、-CN、-SR^6D、-SO₂R^6D、-NR^6AR^6B、-C(O)R^6C、-C(O)OR^6C、-C(O)NR^6AR^6B、-C(O)NR^6AOR^6B、-OR^6D、-NR^6AC(O)R^6C、-NR^6AC(O)OR^6CC substituted or unsubstituted₁-C₆Alkyl or substituted or unsubstituted 2 to 6 membered heteroalkyl.

41. The compound of claim 30, wherein R⁶Independently is-C (O) R^6C、-C(O)OR^6C、-C(O)NR^6AR^6B、-OR^6D、-NR^6AC(O)R^6C、-NR^6AC(O)OR^6CC substituted or unsubstituted₁-C₆Alkyl, substituted or unsubstituted 2 to 6 membered heteroalkyl.

42. The compound of claim 30, wherein R⁶is-F, -OH, -OCH₃、-OCH₂CH₃、-CH₂OH、-CH₂OCH₃、-NHC(O)CH₃、-CH₃、-N(CH₃)₂、-CH₂NH₂、-CH₂N(CH₃)₂、-NH₂、-NHCH₃-COOH or-SO₂CH₃。

43. The compound of claim 30, wherein R⁶is-OH, -OCH₃、-OCH₂CH₃、-CH₂OH or-CH₂OCH₃。

44. The compound of claim 30, wherein R⁶Is substituted or unsubstituted C₁-C₈Alkyl or substituted or unsubstituted 2 to 8 membered heteroalkyl.

45. The compound of claim 30, wherein R⁶Is by R³⁵Substituted or unsubstituted C₁-C₈Alkyl or by R³⁵Substituted or unsubstituted 2 to 8 membered heteroalkyl;

R³⁵is oxo, halogen, -CCl₃、-CBr₃、-CF₃、-CI₃、CHCl₂、-CHBr₂、-CHF₂、-CHI₂、-CH₂Cl、-CH₂Br、-CH₂F、-CH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂、-NHC(O)NH₂、-NHSO₂H、-NHC(O)H、-NHC(O)OH、-NHOH、-OCCl₃、-OCF₃、-OCBr₃、-OCI₃、-OCHCl₂、-OCHBr₂、-OCHI₂、-OCHF₂、-OCH₂Cl、-OCH₂Br、-OCH₂I、-OCH₂F. Substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.

46. The compound of claim 30, wherein R⁶Is that

Wherein z16 is an integer from 1 to 8; and

47. The compound of claim 30, having the formula:

48. the compound of claim 30, having the formula:

49. the compound of claim 30, having the formula:

50. the compound of claim 30, having the formula:

51. the compound of claim 30, having the formula:

52. the compound of claim 30, having the formula:

53. the compound of claim 30, having the formula:

wherein

R³⁵Is oxo, halogen, -CCl₃、-CBr₃、-CF₃、-CI₃、CHCl₂、-CHBr₂、-CHF₂、-CHI₂、-CH₂Cl、-CH₂Br、-CH₂F、-CH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂、-NHC(O)NH₂、-NHSO₂H、-NHC(O)H、-NHC(O)OH、-NHOH、-OCCl₃、-OCF₃、-OCBr₃、-OCI₃、-OCHCl₂、-OCHBr₂、-OCHI₂、-OCHF₂、-OCH₂Cl、-OCH₂Br、-OCH₂I、-OCH₂F. Substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkaneA substituted or unsubstituted heterocycloalkyl, a substituted or unsubstituted aryl, or a substituted or unsubstituted heteroaryl.

54. A compound according to claim 53, wherein R³⁵Is a substituted or unsubstituted heteroalkyl or substituted or unsubstituted heterocycloalkyl.

55. A compound according to claim 53, wherein R³⁵The method comprises the following steps:

56. the compound of claim 1, having the formula:

57. a pharmaceutical composition comprising a compound according to any one of claims 1 to 56 and a pharmaceutically acceptable excipient.

58. A method of inhibiting adenosine A2B receptor activity and adenosine A2A receptor activity, the method comprising contacting the adenosine A2B receptor and adenosine A2A receptor with a compound according to any one of claims 1 to 56.

59. A method of inhibiting adenosine A2B receptor activity, comprising contacting the adenosine A2B receptor with a compound according to any one of claims 1 to 56.

60. A method of treating cancer, comprising administering to a subject in need thereof an effective amount of a compound according to any one of claims 1 to 56.

61. The method of claim 57, wherein the cancer is breast cancer, lung cancer, colon cancer, bladder cancer, kidney cancer, liver cancer, pancreas cancer, melanoma, leukemia, lymphoma, or prostate cancer.

62. A method of treating a neurodegenerative disease, the method comprising administering to a subject in need thereof an effective amount of a compound of any one of claims 1-56.

63. A method of treating a fibrotic disorder, the method comprising administering to a subject in need thereof an effective amount of a compound according to any one of claims 1 to 56.

64. The method of claim 63, wherein the fibrotic disorder is pulmonary fibrosis.

Background

G protein-coupled receptors constitute a large transmembrane protein superfamily that represents the target for almost half of all drugs on sale. Two GPCR family members, the adenosine A2B receptor and the adenosine A2A receptor, are involved in a number of physiological functions. Thus, there is a need in the art for adenosine A2B receptor modulators and adenosine A2A receptor modulators. Provided herein, among other things, are solutions to these and other problems in the art.

Disclosure of Invention

In one aspect, a compound is provided having the formula:

L¹is substituted or unsubstitutedAlkylene or substituted or unsubstituted heteroalkylene. Ring a is aryl or heteroaryl. R¹Independently of one another is halogen, -CX¹ ₃、-CHX¹ ₂、-CH₂X¹、-OCX¹ ₃、-OCH₂X¹、-OCHX¹ ₂、-CN、-SR^1D、-NR^1AR^1B、-C(O)R^1C、-C(O)OR^1C、-C(O)NR^1AR^1B、-OR^1D、-NR^1AC(O)R^1C、-NR^1AC(O)OR^1C、-SO₂R^1D、-SO₂NR^1AR^1B、-NR^1ASO₂R^1DSubstituted or unsubstituted alkyl or substituted or unsubstituted heteroalkyl. The symbol z1 is an integer from 0 to 5. R²Independently hydrogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. R³Independently hydrogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. R²And R³May optionally be joined to form a substituted or unsubstituted heterocycloalkyl group. R⁴Independently hydrogen, halogen, -CX⁴ ₃、-CHX⁴ ₂、-CH₂X⁴、-OCX⁴ ₃、-OCH₂X⁴、-OCHX⁴ ₂、-CN、-SR^4D、-NR^4AR^4B、-C(O)R^4C、-C(O)OR^4C、-C(O)NR^4AR^4B、-OR^4D、-NR^4AC(O)R^4C、-NR^4AC(O)OR^4CSubstituted or unsubstituted alkyl or substituted or unsubstituted heteroalkyl. R⁵Independently hydrogen, halogen, -CX⁵ ₃、-CHX⁵ ₂、-CH₂X⁵、-OCX⁵ ₃、-OCH₂X⁵、-OCHX⁵ ₂、-CN、-SR^5D、-NR^5AR^5B、-C(O)R^5C、-C(O)OR^5C、-C(O)NR^5AR^5B、-OR^5D、-NR^5AC(O)R^5C、-NR^5AC(O)OR^5CSubstituted or unsubstituted alkyl or substituted or unsubstituted heteroalkyl. Each R^1A、R^1B、R^1C、R^1D、R^4A、R^4B、R^4C、R^4D、R^5A、R^5B、R^5CAnd R^5DIndependently hydrogen, halogen, -CF₃、-CBr₃、-CCl₃、-CI₃、-CHF₂、-CHBr₂、-CHCl₂、-CHI₂、-CH₂F、-CH₂Br、-CH₂Cl、-CH₂I、-OCF₃、-OCBr₃、-OCCl₃、-OCI₃、-OCHF₂、-OCHBr₂、-OCHCl₂、-OCHI₂、-OCH₂F、-OCH₂Br、-OCH₂Cl、-OCH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂、-NHC(O)NH₂、-NHSO₂H. -NHC (O) H, -NHC (O) OH, -NHOH, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. R bound to the same nitrogen atom^1AAnd R^1BThe substituents may optionally join to form a substituted or unsubstituted heterocycloalkyl. R bound to the same nitrogen atom^4AAnd R^4BThe substituents may optionally join to form a substituted or unsubstituted heterocycloalkyl. R bound to the same nitrogen atom^5AAnd R^5BThe substituents may optionally join to form a substituted or unsubstituted heterocycloalkyl. Each one ofX¹、X⁴And X⁵Independently is-F, -Cl, -Br or-I.

In one aspect, there is provided a pharmaceutical composition comprising a compound as described herein and a pharmaceutically acceptable excipient.

In another aspect, there is provided a method of inhibiting the activity of the adenosine A2B receptor, comprising contacting the adenosine A2B receptor with a compound as described herein, including the examples.

In one aspect, there is provided a method of inhibiting adenosine receptor activity, the method comprising contacting the adenosine receptor (e.g., a1, A2A, A2B, or A3) with a compound as described herein, including the examples.

Detailed Description

I. Definition of

The abbreviations used herein have their conventional meaning in the chemical and biological arts. The chemical structures and chemical formulae set forth herein are constructed according to standard rules of chemical valency known in the chemical art.

When substituents are illustrated by conventional formulas written from left to right, the substituents are equally intended to encompass the chemically identical result from writing the structure from right to leftSubstituents, e.g. -CH₂O-is equivalent to-OCH₂-。

Unless otherwise specified, the term "alkyl" alone or as part of another substituent means a straight (i.e., unbranched) or branched carbon chain (or carbon), or combination thereof, which may be fully saturated, mono-unsaturated, or polyunsaturated, and may contain monovalent, divalent, and multivalent groups. The alkyl group may contain a specified number of carbons (e.g., C)₁-C₁₀Meaning one to ten carbons). Alkyl is an acyclic chain. Examples of saturated hydrocarbon groups include (but are not limited to) groups such as: methyl, ethyl, n-propyl, isopropyl, n-butyl, tert-butyl, isobutyl, sec-butyl, methyl, homologs and isomers of, for example, n-pentyl, n-hexyl, n-heptyl, n-octyl, and the like. Unsaturated alkyl is alkyl having one or more double or triple bonds. Examples of unsaturated alkyl groups include, but are not limited to, ethenyl, 2-propenyl, crotyl, 2-isopentenyl, 2- (butadienyl), 2, 4-pentadienyl, 3- (1, 4-pentadienyl), ethynyl, 1-and 3-propynyl, 3-butynyl, and higher homologs and isomers. An alkoxy group is an alkyl group attached to the rest of the molecule through an oxygen linker (-O-). The alkyl moiety may be an alkenyl moiety. The alkyl moiety may be an alkynyl moiety. The alkyl moiety may be fully saturated. In addition to one or more double bonds, an alkenyl group may contain more than one double bond and/or one or more triple bonds. In addition to one or more triple bonds, an alkynyl group may contain more than one triple bond and/or one or more double bonds.

Unless otherwise specified, the term "alkylene" alone or as part of another substituent means a divalent group derived from an alkyl group, such as (but not limited to) -CH₂CH₂CH₂CH₂-. Typically, the alkyl (or alkylene) groups will have from 1 to 24 carbon atoms, with those groups having 10 or fewer carbon atoms being preferred herein. "lower alkyl" or "lower alkylene" is a short chain alkyl or alkylene group typically having eight or fewer carbon atoms. The term "alkenylene", alone or as part of another substituent, means, unless otherwise stated, derivedA divalent group derived from an olefin.

Unless otherwise specified, the term "heteroalkyl," alone or in combination with another term, means a stable straight or branched chain comprising at least one carbon atom and at least one heteroatom (e.g., O, N, P, Si and S, and wherein the nitrogen and sulfur atoms may optionally be oxidized, and the nitrogen heteroatom may optionally be quaternized), or a combination thereof. The heteroatom (e.g., N, S, Si or P) may be located at any internal position of the heteroalkyl group or at the position where the alkyl group is attached to the remainder of the molecule. Heteroalkyl is an acyclic chain. Examples include (but are not limited to): -CH₂-CH₂-O-CH₃、-CH₂-CH₂-NH-CH₃、-CH₂-CH₂-N(CH₃)-CH₃、-CH₂-S-CH₂-CH₃、-CH₂-S-CH₂、-S(O)-CH₃、-CH₂-CH₂-S(O)₂-CH₃、-CH＝CH-O-CH₃、-Si(CH₃)₃、-CH₂-CH＝N-OCH₃、-CH＝CH-N(CH₃)-CH₃、-O-CH₃、-O-CH₂-CH₃and-CN. Up to two or three heteroatoms may be consecutive, e.g. -CH₂-NH-OCH₃and-CH₂-O-Si(CH₃)₃. The heteroalkyl moiety may include one heteroatom (e.g., O, N, S, Si or P). The heteroalkyl moiety may comprise two optionally different heteroatoms (e.g., O, N, S, Si or P). The heteroalkyl moiety may comprise three optionally different heteroatoms (e.g., O, N, S, Si or P). The heteroalkyl moiety may comprise four optionally different heteroatoms (e.g., O, N, S, Si or P). The heteroalkyl moiety may comprise five optionally different heteroatoms (e.g., O, N, S, Si or P). The heteroalkyl moiety may contain up to 8 optionally different heteroatoms (e.g., O, N, S, Si or P). Unless otherwise specified, the term "heteroalkenyl" means, alone or in combination with another term, a heteroalkyl group that includes at least one double bond. In addition to one or more double bonds, a heteroalkenyl group can optionally include more than one double bond and/or one or more triple bonds. Unless otherwise indicated, alone or in combination with another term,the term "heteroalkynyl" means a heteroalkyl group containing at least one triple bond. In addition to one or more triple bonds, a heteroalkynyl group can optionally contain more than one triple bond and/or one or more double bonds.

Similarly, unless otherwise specified, the term "heteroalkylene," alone or as part of another substituent, means a divalent radical derived from a heteroalkyl group, such as (but not limited to) -CH₂-CH₂-S-CH₂-CH₂-and-CH₂-S-CH₂-CH₂-NH-CH₂-. For heteroalkylene groups, heteroatoms can also occupy either or both of the chain ends (e.g., alkyleneoxy, alkylenedioxy, alkyleneamino, alkylenediamino, and the like). In addition, for alkylene and heteroalkylene linking groups, the written direction of the formula for the linking group does not imply orientation of the linking group. For example, of the formula-C (O)₂R' -represents-C (O)₂R '-and-R' C (O)₂-two. As described above, heteroalkyl, as used herein, includes those groups attached to the remainder of the molecule through a heteroatom, such as-C (O) R ', -C (O) NR ', -NR ' R ", -OR ', -SR ', and/OR-SO₂R' is provided. When "heteroalkyl" is recited, followed by a particular heteroalkyl, such as-NR 'R "or the like, it is understood that the terms heteroalkyl and-NR' R" are not redundant or mutually exclusive. Rather, specific heteroalkyl groups are recited for added clarity. Thus, the term "heteroalkyl" should not be construed herein to exclude a particular heteroalkyl, such as-NR' R "or the like.

Unless otherwise specified, the terms "cycloalkyl" and "heterocycloalkyl", alone or in combination with other terms, mean the cyclic forms of "alkyl" and "heteroalkyl", respectively. Cycloalkyl and heterocycloalkyl groups are not aromatic. In addition, for heterocycloalkyl, a heteroatom may occupy the position at which the heterocycle is attached to the rest of the molecule. Examples of cycloalkyl groups include, but are not limited to, cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, 1-cyclohexenyl, 3-cyclohexenyl, cycloheptyl, and the like. Examples of heterocycloalkyl include, but are not limited to, 1- (1,2,5, 6-tetrahydropyridyl), 1-piperidinyl, 2-piperidinyl, 3-piperidinyl, 4-morpholinyl, 3-morpholinyl, tetrahydrofuran-2-yl, tetrahydrofuran-3-yl, tetrahydrothiophen-2-yl, tetrahydrothiophen-3-yl, 1-piperazinyl, 2-piperazinyl, and the like. By "cycloalkylene" and "heterocycloalkylene", alone or as part of another substituent, is meant a divalent radical derived from a cycloalkyl and a heterocycloalkyl, respectively.

The term "halo" or "halogen", alone or as part of another substituent, means, unless otherwise stated, a fluorine, chlorine, bromine or iodine atom. Additionally, terms such as "haloalkyl" are meant to encompass monohaloalkyl and polyhaloalkyl. For example, the term "halo (C)₁-C₄) Alkyl "includes, but is not limited to, fluoromethyl, difluoromethyl, trifluoromethyl, 2,2, 2-trifluoroethyl, 4-chlorobutyl, 3-bromopropyl, and the like.

Unless otherwise indicated, the term "acyl" means-c (o) R, wherein R is substituted or unsubstituted alkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.

Unless otherwise indicated, the term "aryl" means a polyunsaturated aromatic hydrocarbon substituent which may be a single ring or multiple rings (preferably 1 to 3 rings) which are fused together (i.e., a fused ring aryl) or covalently linked. Fused ring aryl refers to multiple rings fused together, wherein at least one of the fused rings is an aryl ring. The term "heteroaryl" refers to an aryl (or ring) containing at least one heteroatom, such as N, O or S, wherein the nitrogen and sulfur atoms are optionally oxidized and the nitrogen atoms are optionally quaternized. Thus, the term "heteroaryl" encompasses fused ring heteroaryl groups (i.e., multiple rings fused together wherein at least one of the fused rings is a heteroaromatic ring). A 5, 6-fused ring heteroarylene refers to two rings fused together, wherein one ring has 5 members and the other ring has 6 members, and wherein at least one ring is a heteroaryl ring. Likewise, a 6, 6-fused ring heteroarylene refers to two rings fused together, wherein one ring has 6 members and the other ring has 6 members, and wherein at least one ring is a heteroaryl ring. And 6, 5-fused ring heteroarylene refers to two rings fused together, wherein one ring has 6 members and the other ring has 5 members, and wherein at least one ring is a heteroaryl ring. The heteroaryl group may be attached to the rest of the molecule through a carbon or heteroatom. Non-limiting examples of aryl and heteroaryl groups include: phenyl, naphthyl, pyrrolyl, pyrazolyl, pyridazinyl, triazinyl, pyrimidinyl, imidazolyl, pyrazinyl, purinyl, oxazolyl, isoxazolyl, thiazolyl, furyl, thienyl, pyridyl, pyrimidinyl, benzothiazolyl, benzoxazolyl, benzimidazolyl, benzofuran, isobenzofuryl, indolyl, isoindolyl, benzothienyl, isoquinolyl, quinolyl, 1-naphthyl, 2-naphthyl, 4-biphenyl, 1-pyrrolyl, 2-pyrrolyl, 3-pyrazolyl, 2-imidazolyl, 4-imidazolyl, pyrazinyl, 2-oxazolyl, 4-oxazolyl, 2-phenyl-4-oxazolyl, 5-oxazolyl, 3-isoxazolyl, 4-isoxazolyl, pyridazinyl, triazinyl, pyrimidinyl, imidazolyl, pyrazinyl, purinyl, quinoxalyl, 2-naphthyl, 4-biphenyl, 4-oxazolyl, 5-oxazolyl, 3-isoxazolyl, 4-isoxazolyl, etc, 5-isoxazolyl, 2-thiazolyl, 4-thiazolyl, 5-thiazolyl, 2-furyl, 3-furyl, 2-thienyl, 3-thienyl, 2-pyridyl, 3-pyridyl, 4-pyridyl, 2-pyrimidyl, 4-pyrimidyl, 5-benzothiazolyl, purinyl, 2-benzimidazolyl, 5-indolyl, 1-isoquinolyl, 5-isoquinolyl, 2-quinolyl, 5-quinolyl, 3-quinolyl and 6-quinolyl. The substituents for each of the above-indicated aryl and heteroaryl ring systems are selected from the group of acceptable substituents described below. By "arylene" and "heteroarylene", alone or as part of another substituent, is meant a divalent radical derived from an aryl and heteroaryl group, respectively. The heteroaryl substituent may be-O-bonded to the nitrogen ring heteroatom.

A spiro ring is two or more rings in which adjacent rings are connected by a single atom. The individual rings within a spiro ring may be the same or different. Individual rings in the spiro ring may be substituted or unsubstituted, and may have different substituents than other individual rings in the spiro ring group. Possible substituents for individual rings in a spiro ring are possible substituents for the same ring when not part of a spiro ring (e.g., substituents for cycloalkyl or heterocycloalkyl rings). The spirocyclic ring can be substituted or unsubstituted cycloalkyl, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkyl, or substituted or unsubstituted heterocycloalkylene, and individual rings within the spirocyclic group can be any of the immediately preceding list, including all rings having one type (e.g., all rings of a substituted heterocycloalkylene, where each ring can be the same or different substituted heterocycloalkylene). When referring to a spiro ring system, heterocyclic spiro ring means a spiro ring in which at least one ring is heterocyclic and in which each ring may be a different ring. When referring to a spiro ring system, substituted spirocyclic means that at least one ring is substituted and each substituent may optionally be different.

SymbolDenotes the point of attachment of a chemical moiety to the rest of the molecule or formula.

As used herein, the term "oxo" means an oxygen double bonded to a carbon atom.

The term "alkylarylene" is an arylene moiety covalently bonded to an alkylene moiety (also referred to herein as an alkylene linker). In embodiments, the alkylarylene group has the formula:

the alkylarylene moiety may be substituted (e.g., by a substituent) on the alkylene moiety or the arylene linker (e.g., at carbon 2, 3, 4, or 6) by: halogen, oxo, -N₃、-CF₃、-CCl₃、-CBr₃、-CI₃、-CN、-CHO、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₂CH₃-SO₃H、-OSO₃H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂C substituted or unsubstituted₁-C₅Alkyl or substituted or unsubstituted 2 to 5 membered heteroalkyl). In the examples, alkylarylene radicalsIs unsubstituted.

Each of the above terms (e.g., "alkyl," "heteroalkyl," "cycloalkyl," "heterocycloalkyl," "aryl," and "heteroaryl") encompasses both substituted and unsubstituted forms of the indicated group. Preferred substituents for each type of group are provided below.

Substituents for alkyl and heteroalkyl (including those commonly referred to as alkylene, alkenyl, heteroalkylene, heteroalkenyl, alkynyl, cycloalkyl, heterocycloalkyl, cycloalkenyl, and heterocycloalkenyl) can be one or more of a variety of groups selected from, but not limited to: -OR ', - (O), (NR ', - (N-OR ', - (NR ' R ", -SR ', halogen, -SiR ' R" R ' ", -oc (O) R ', -c (O) R ', -CO₂R'、-CONR'R"、-OC(O)NR'R"、-NR"C(O)R'、-NR'-C(O)NR"R"'、-NR"C(O)₂R'、-NR-C(NR'R"R"')＝NR""、-NR-C(NR'R")＝NR"'、-S(O)R'、-S(O)₂R'、-S(O)₂NR'R"、-NRSO₂R'、-NR'NR"R"'、-ONR'R"、-NR'C(O)NR"NR"'R""、-CN、-NO₂、-NR'SO₂R ", -NR 'C (O) -OR", -NR' OR ", in a number ranging from zero to (2m '+1), where m' is the total number of carbon atoms in such a group. R, R ', R ", R'" and R "" each preferably independently mean hydrogen, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl (e.g., aryl substituted with 1-3 halogens), substituted or unsubstituted heteroaryl, substituted or unsubstituted alkyl, alkoxy, or thioalkoxy or aralkyl. When the compounds described herein comprise more than one R group, for example, each of the R groups is independently selected as are each R ', R ", R'" and R "" groups when more than one of these groups is present. When R' and R "are attached to the same nitrogen atom, they may combine with the nitrogen atom to form a 4-, 5-, 6-or 7-membered ring. For example, -NR' R "includes, but is not limited to, 1-pyrrolidinyl and 4-morpholinyl. From the above discussion of substituents, it will be understood by those skilled in the art that the term "alkyl" is intended to encompass groups containing carbon atoms bonded to groups other than hydrogen, such as haloAlkyl radicals (e.g., -CF)₃and-CH₂CF₃) And acyl (e.g., -C (O) CH)₃、-C(O)CF₃、-C(O)CH₂OCH₃And the like).

Similar to the substituents described for alkyl, the substituents for aryl and heteroaryl are different and are selected, for example, from the following: -OR ', -NR ' R ", -SR ', -halo, -SiR ' R" R ' ", -OC (O) R ', -C (O) R ', -CO₂R'、-CONR'R"、-OC(O)NR'R"、-NR"C(O)R'、-NR'-C(O)NR"R"'、-NR"C(O)₂R'、-NR-C(NR'R"R"')＝NR""、-NR-C(NR'R")＝NR"'、-S(O)R'、-S(O)₂R'、-S(O)₂NR'R"、-NRSO₂R'、-NR'NR"R"'、-ONR'R"、-NR'C(O)NR"NR"'R""、-CN、-NO₂、-R'、-N₃、-CH(Ph)₂Fluorine (C)₁-C₄) Alkoxy, and fluorine (C)₁-C₄) Alkyl, -NR' SO₂R ", -NR 'C (O) -OR", -NR' OR ", in an amount ranging from zero to the total number of open valences on the aromatic ring system; and wherein R ', R ", R'" and R "" are preferably independently selected from the group consisting of hydrogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl. When the compounds described herein comprise more than one R group, for example, each of the R groups is independently selected as are each R ', R ", R'" and R "" groups when more than one of these groups is present.

Substituents on a ring (e.g., cycloalkyl, heterocycloalkyl, aryl, heteroaryl, cycloalkylene, heterocycloalkylene, arylene, or heteroarylene) can be described as substituents on the ring (often referred to as floating substituents) other than the specified atoms on the ring. In this case, a substituent may be attached to any of the ring atoms (following the rules of chemical valency), and in the case of a fused ring or spiro ring, a substituent described as being bound to one member of the fused ring or spiro ring (floating substituent on a single ring), may be a substituent on any of the fused ring or spiro ring (floating substituent on multiple rings). When a substituent is attached to a ring other than a particular atom (a floating substituent) and the subscript of the substituent is an integer greater than one, multiple substituents can be on the same atom, the same ring, different atoms, different spiro rings of different fused rings, and each substituent can optionally be different. When the point of attachment of a ring to the rest of the molecule is not limited to a single atom (floating substituent), the point of attachment may be any atom of the ring, and in the case of a fused ring or spiro ring, may be any atom of either the fused ring or spiro ring while following the rules of chemical valency. When a ring, fused ring, or spiro ring contains one or more ring heteroatoms and the ring, fused ring, or spiro ring is shown to have yet another (one more) floating substituent (including, but not limited to, the point of attachment to the rest of the molecule), the floating substituent may be bonded to the heteroatom. When a ring heteroatom is shown bound to one or more hydrogens in a structure or formula with a floating substituent (e.g., two bonds are bound to the ring atom and the third bond is a ring nitrogen bound to a hydrogen), when the heteroatom is bound to a floating substituent, the substituent will be understood to replace the hydrogen while following the chemical valence rules.

Two or more substituents may optionally be joined to form an aryl, heteroaryl, cycloalkyl, or heterocycloalkyl group. Such so-called ring-forming substituents are typically, but not necessarily, found attached to a cyclic base structure. In one embodiment, the ring-forming substituent is attached to an adjacent member of the base structure. For example, two rings connected to adjacent members of a cyclic base structure form a substituent to produce a fused ring structure. In another embodiment, the ring-forming substituent is attached to a single member of the base structure. For example, two rings attached to a single member of a cyclic base structure form a substituent resulting in a spiro ring structure. In yet another embodiment, the ring-forming substituent is attached to a non-adjacent member of the base structure.

Two of the substituents on adjacent atoms of the aryl or heteroaryl ring may optionally form a compound of the formula-T-C (O) - (CRR')_q-U-, wherein T and U are independently-NR-, -O-, -CRR' -or a single bond, and q is an integer of 0 to 3. Alternatively, two of the substituents on adjacent atoms of the aryl or heteroaryl ring may optionally be substituted with a group of formula-A- (CH)₂)_rSubstitution of the substituents of-B-,wherein A and B are independently-CRR' -, -O-, -NR-, -S (O)₂-、-S(O)₂NR' -or a single bond, and r is an integer of 1 to 4. One of the single bonds of the new ring thus formed may optionally be replaced with a double bond. Alternatively, two of the substituents on adjacent atoms of the aryl or heteroaryl ring may optionally be substituted with a compound of the formula- (CRR ') s-X ' - (C "R" R ' ")_d-wherein S and d are independently integers from 0 to 3, and X 'is-O-, -NR' -, -S (O)₂-or-S (O)₂NR' -. Substituents R, R ', R ", and R'" are preferably independently selected from the group consisting of hydrogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl.

As used herein, "substituent" means a group selected from the following moieties:

(A) oxo, halogen, -CCl₃、-CBr₃、-CF₃、-CI₃、CHCl₂、-CHBr₂、-CHF₂、-CHI₂、-CH₂Cl、-CH₂Br、-CH₂F、-CH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂、-NHC(O)NH₂、-NHSO₂H、-NHC(O)H、-NHC(O)OH、-NHOH、-OCCl₃、-OCF₃、-OCBr₃、-OCI₃、-OCHCl₂、-OCHBr₂、-OCHI₂、-OCHF₂、-OCH₂Cl、-OCH₂Br、-OCH₂I、-OCH₂F、-N₃Unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl), unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl), unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl), unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl), unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl or phenyl), or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl), and

(B) alkyl, heteroalkyl, cycloalkyl, heterocycloalkyl, aryl, heteroaryl, said groups substituted with at least one substituent selected from the group consisting of:

(i) oxo, halogen, -CCl₃、-CBr₃、-CF₃、-CI₃、CHCl₂、-CHBr₂、-CHF₂、-CHI₂、-CH₂Cl、-CH₂Br、-CH₂F、-CH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂、-NHC(O)NH₂、-NHSO₂H、-NHC(O)H、-NHC(O)OH、-NHOH、-OCCl₃、-OCF₃、-OCBr₃、-OCI₃、-OCHCl₂、-OCHBr₂、-OCHI₂、-OCHF₂、-OCH₂Cl、-OCH₂Br、-OCH₂I、-OCH₂F、-N₃Unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl), unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl), unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl), unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl), unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl) or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 9-membered heteroaryl6-membered heteroaryl), and

(ii) alkyl, heteroalkyl, cycloalkyl, heterocycloalkyl, aryl, heteroaryl, said groups substituted with at least one substituent selected from the group consisting of:

(a) oxo, halogen, -CCl₃、-CBr₃、-CF₃、-CI₃、CHCl₂、-CHBr₂、-CHF₂、-CHI₂、-CH₂Cl、-CH₂Br、-CH₂F、-CH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂、-NHC(O)NH₂、-NHSO₂H、-NHC(O)H、-NHC(O)OH、-NHOH、-OCCl₃、-OCF₃、-OCBr₃、-OCI₃、-OCHCl₂、-OCHBr₂、-OCHI₂、-OCHF₂、-OCH₂Cl、-OCH₂Br、-OCH₂I、-OCH₂F、-N₃Unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl), unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl), unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl), unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl), unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl) or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl), and

(b) alkyl, heteroalkyl, cycloalkyl, heterocycloalkyl, aryl, heteroaryl, said groups substituted with at least one substituent selected from the group consisting of: oxo, halogen, -CCl₃、-CBr₃、-CF₃、-CI₃、CHCl₂、-CHBr₂、-CHF₂、-CHI₂、-CH₂Cl、-CH₂Br、-CH₂F、-CH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂、-NHC(O)NH₂、-NHSO₂H、-NHC(O)H、-NHC(O)OH、-NHOH、-OCCl₃、-OCF₃、-OCBr₃、-OCI₃、-OCHCl₂、-OCHBr₂、-OCHI₂、-OCHF₂、-OCH₂Cl、-OCH₂Br、-OCH₂I、-OCH₂F、-N₃Unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl), unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl), unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl), unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl), unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl) or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl).

As used herein, "size-limited substituent group" means a group selected from all substituents described above for "substituent group", wherein each substituted or unsubstituted alkyl group is substituted or unsubstituted C₁-C₂₀Alkyl, each substituted or unsubstituted heteroalkyl is substituted or unsubstituted 2 to 20 membered heteroalkyl, each substituted or unsubstituted cycloalkyl is substituted or unsubstituted C₃-C₈Cycloalkyl, each substituted or unsubstituted heterocycloalkyl is substituted or unsubstituted 3 to 8 membered heterocycloalkyl, each substituted or unsubstituted aryl is substituted or unsubstituted C₆-C₁₀Aryl, and each substituted or unsubstituted heteroaryl is a substituted or unsubstituted 5-to 10-membered heteroaryl.

As used herein, "lower number substituent (lower substituent group)" means a group selected from all substituents described above for "substituent", wherein each substituted or unsubstituted alkyl group is substituted or unsubstituted C₁-C₈Alkyl, each substituted or unsubstituted heteroalkyl is substituted or unsubstituted 2 to 8 membered heteroalkyl, each substituted or unsubstituted cycloalkyl is substituted or unsubstituted C₃-C₇Cycloalkyl, each substituted or unsubstituted heterocycloalkyl is substituted or unsubstituted 3 to 7 membered heterocycloalkyl, each substituted or unsubstituted aryl is substituted or unsubstituted C₆-C₁₀Aryl, and each substituted or unsubstituted heteroaryl is a substituted or unsubstituted 5-to 9-membered heteroaryl.

In some embodiments, each substituted group described in the compounds herein is substituted with at least one substituent. More specifically, in some embodiments, each substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, substituted heteroaryl, substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroarylene described herein is substituted with at least one substituent. In other embodiments, at least one or all of these groups are substituted with at least one size-limiting substituent. In other embodiments, at least one or all of these groups are substituted with at least one lower number substituent.

In other embodiments of the compounds herein, each substituted or unsubstituted alkyl may be substituted or unsubstituted C₁-C₂₀Alkyl, each substituted or unsubstituted heteroalkyl is substituted or unsubstituted 2 to 20 membered heteroalkyl, each substituted or unsubstituted cycloalkyl is substitutedSubstituted or unsubstituted C₃-C₈Cycloalkyl, each substituted or unsubstituted heterocycloalkyl is substituted or unsubstituted 3 to 8 membered heterocycloalkyl, each substituted or unsubstituted aryl is substituted or unsubstituted C₆-C₁₀Aryl, and/or each substituted or unsubstituted heteroaryl is a substituted or unsubstituted 5-to 10-membered heteroaryl. In some embodiments of the compounds herein, each substituted or unsubstituted alkylene is substituted or unsubstituted C₁-C₂₀Alkylene, each substituted or unsubstituted heteroalkylene being substituted or unsubstituted 2-to 20-membered heteroalkylene, each substituted or unsubstituted cycloalkylene being substituted or unsubstituted C₃-C₈Cycloalkylene, each substituted or unsubstituted heterocycloalkylene is substituted or unsubstituted 3-to 8-membered heterocycloalkylene, each substituted or unsubstituted arylene is substituted or unsubstituted C₆-C₁₀The arylene group, and/or each substituted or unsubstituted heteroarylene group is a substituted or unsubstituted 5-to 10-membered heteroarylene group.

In some embodiments, each substituted or unsubstituted alkyl is substituted or unsubstituted C₁-C₈Alkyl, each substituted or unsubstituted heteroalkyl is substituted or unsubstituted 2 to 8 membered heteroalkyl, each substituted or unsubstituted cycloalkyl is substituted or unsubstituted C₃-C₇Cycloalkyl, each substituted or unsubstituted heterocycloalkyl is substituted or unsubstituted 3 to 7 membered heterocycloalkyl, each substituted or unsubstituted aryl is substituted or unsubstituted C₆-C₁₀Aryl, and/or each substituted or unsubstituted heteroaryl is a substituted or unsubstituted 5-to 9-membered heteroaryl. In some embodiments, each substituted or unsubstituted alkylene is substituted or unsubstituted C₁-C₈Alkylene, each substituted or unsubstituted heteroalkylene being substituted or unsubstituted 2-to 8-membered heteroalkylene, each substituted or unsubstituted cycloalkylene being substituted or unsubstituted C₃-C₇Cycloalkylene, each substituted or unsubstituted heterocycloalkylene is substituted or unsubstituted 3-to 7-membered heterocycloalkylene, each substituted or unsubstituted arylene is substituted or unsubstituted C₆-C₁₀The arylene group, and/or each substituted or unsubstituted heteroarylene group is a substituted or unsubstituted 5-to 9-membered heteroarylene group. In some embodiments, the compound is a chemical species set forth in the examples section, figures, or tables below.

In embodiments, a substituted or unsubstituted moiety (e.g., substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, and/or substituted or unsubstituted heteroarylene) is unsubstituted (e.g., unsubstituted alkyl, unsubstituted heteroalkyl, unsubstituted cycloalkyl, unsubstituted heterocycloalkyl, unsubstituted aryl, unsubstituted heteroaryl, unsubstituted alkylene, substituted or unsubstituted heteroarylene, respectively) is unsubstituted (e.g., unsubstituted alkyl, unsubstituted heteroalkyl, unsubstituted cycloalkyl, unsubstituted heterocycloalkyl, unsubstituted aryl, unsubstituted heteroaryl, unsubstituted alkylene, substituted or unsubstituted heteroarenyl, respectively), Unsubstituted heteroalkylene, unsubstituted cycloalkylene, unsubstituted heterocycloalkylene, unsubstituted arylene, and/or unsubstituted heteroarylene). In embodiments, a substituted or unsubstituted moiety (e.g., substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, and/or substituted or unsubstituted heteroarylene) is substituted (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, substituted heteroaryl, substituted alkylene, substituted heteroalkylene, substituted heteroaryl, substituted, Substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroarylene).

In embodiments, a substituted moiety (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, substituted heteroaryl, substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroarylene) is substituted with at least one size-limiting substituent, wherein each size-limiting substituent may optionally be different if the substituted moiety is substituted with multiple size-limiting substituents. In embodiments, if a substituted moiety is substituted with multiple size-limited substituents, each size-limited substituent is different.

In embodiments, a substituted moiety (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, substituted heteroaryl, substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroarylene) is substituted with at least one lower carbon number substituent, wherein if the substituted moiety is substituted with a plurality of lower carbon number substituents, each lower carbon number substituent may optionally be different. In embodiments, if the substituted moiety is substituted with a plurality of lower carbon number substituents, each lower carbon number substituent is different.

In embodiments, a substituted moiety (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, substituted heteroaryl, substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroarylene) is substituted with at least one substituent, size-limiting substituent, or lower number substituent; wherein if the substituted moiety is substituted with a plurality of groups selected from substituents, size-limiting substituents and lower-number substituents, each substituent, size-limiting substituent and/or lower-number substituent may optionally be different. In embodiments, if the substituted moiety is substituted with a plurality of groups selected from substituents, size-limiting substituents, and lower-number substituents, each substituent, size-limiting substituent, and/or lower-number substituent is different.

Certain compounds of the present invention possess asymmetric carbon atoms (optical or chiral centers) or double bonds; defined in terms of absolute stereochemistry as enantiomers, racemates, diastereomers, tautomers, geometric isomers, stereoisomeric forms, and individual isomers in (R) -or (S) -or (D) -or (L) for amino acids are encompassed within the scope of the present invention. The compounds of the present invention do not include those known in the art to be too unstable to synthesize and/or isolate. The present invention is meant to encompass the compounds in racemic and optically pure form. Optically active (R) -and (S) -, or (D) -and (L) -isomers can be prepared using chiral synthons or chiral reagents, or resolved using conventional techniques. When the compounds described herein contain an olefinic bond or other geometric asymmetric center, and unless otherwise specified, it is intended that the compounds contain both the E and Z geometric isomers.

As used herein, the term "isomer" refers to compounds having the same number and kind of atoms, and thus the same molecular weight, but having different structural arrangements or atom configurations.

As used herein, the term "tautomer" refers to one of two or more structural isomers that exist in equilibrium and are readily converted from one isomeric form to another.

It will be apparent to those skilled in the art that certain compounds of the invention may exist in tautomeric forms, all such tautomeric forms of the compounds being within the scope of the invention.

Unless otherwise specified, the structures depicted herein are also meant to encompass all stereochemical forms of the structures; i.e., the R and S configuration of each asymmetric center. Thus, single stereochemical isomers as well as enantiomeric and diastereomeric mixtures of the compounds of the present invention are within the scope of the invention.

Unless otherwise indicated, the structures depicted herein are also meant to include compounds that differ only in the presence of one or more isotopically enriched atoms. For example, except that hydrogen is replaced by deuterium or tritium or carbon is replaced by¹³C or¹⁴In addition to carbon substitution by C enrichment, compounds having the structure of the present invention are within the scope of the present invention.

The compounds of the present invention may also contain unnatural proportions of atomic isotopes at one or more of the atoms that constitute such compounds. For example, the compound may be radiolabeled with a radioisotope, such as tritium (A)³H) Iodine-125 (¹²⁵I) Or carbon-14 (¹⁴C) In that respect All isotopic variations of the compounds of the present invention, whether radioactive or not, are intended to be encompassed within the scope of the present invention.

It should be noted that throughout the application, substitutes are written in the Markush group, e.g., each amino acid position containing more than one possible amino acid. It is specifically contemplated that each member of the Markush group should be considered separately, thereby including another embodiment, and that the Markush group should not be read as a single unit.

"Analog/Analog" is used according to its usual meaning in chemistry and biology and refers to a compound that is structurally similar to another compound (i.e., a so-called "reference" compound) but differs in composition, for example, in that one atom is replaced by a different element atom, or a particular functional group is present, or one functional group is replaced by another functional group, or the absolute stereochemistry of one or more chiral centers of the reference compound. Thus, an analog is a compound that is similar or equivalent in function and appearance to a reference compound, but not in structure or origin.

The terms "a" and "an," as used herein, mean one or more. Further, as used herein, the phrase "being a [ n ]]Substituted means that the specified group may be substituted with any or all of one or more of the proposed substituents. For example, when a group, such as alkyl or heteroaryl, "is unsubstituted C₁-C₂₀When alkyl or unsubstituted 2-to 20-membered heteroalkyl is substituted ", the group may contain one or more unsubstituted C₁-C₂₀Alkyl, and/or one or more unsubstituted 2-to 20-membered heteroalkyl.

Further, when a moiety is substituted with an R substituent, the group may be referred to as "R-substituted". When a moiety is substituted with R, the moiety is substituted with at least one R substituent, and each R substituent is optionally different. When a particular R group is present in the description of a chemical species (as in formula (I)), a roman alphabet symbol may be used to distinguish each occurrence of the particular R group. For example, when multiple R' s¹³When a substituent is present, each R¹³The substituent may be R^13A、R^13B、R^13C、R^13DAre distinguished wherein R^13A、R^13B、R^13C、R^13DEach of which is defined in R¹³Within the defined ranges, and optionally different.

The term "pharmaceutically acceptable salt" is intended to encompass salts of the active compounds prepared with relatively nontoxic acids or bases, depending on the particular substituents found on the compounds described herein. When the compounds of the present invention contain relatively acidic functional groups, base addition salts can be obtained by contacting the neutral forms of such compounds with a sufficient amount of the desired base, neat or in a suitable inert solvent. Examples of pharmaceutically acceptable base addition salts include sodium, potassium, calcium, ammonium, organic ammonium or magnesium salts or the like. When the compounds of the present invention contain relatively basic functional groups, acid addition salts can be obtained by contacting the neutral form of such compounds with a sufficient amount of the desired acid, neat or in a suitable inert solvent. Examples of pharmaceutically acceptable acid addition salts include those derived from inorganic acids such as hydrochloric acid, hydrobromic acid, nitric acid, carbonic acid, monohydrogencarbonic acid, phosphoric acid, monohydrogenphosphoric acid, dihydrogenphosphoric acid, sulfuric acid, monohydrogensulfuric acid, hydroiodic acid, or phosphorous acid and the like; and salts derived from relatively nontoxic organic acids such as acetic, propionic, isobutyric, maleic, malonic, benzoic, succinic, suberic, fumaric, lactic, mandelic, phthalic, benzenesulfonic, p-tolylsulfonic, citric, tartaric, oxalic, methanesulfonic, and the like. Also included are salts of amino acids such as arginine salts and the like; and Salts of organic acids, such as glucuronic acid or galacturonic acid, and the like (see, e.g., Berge et al, "Pharmaceutical Salts," Journal of Pharmaceutical Science, 1977,66, 1-19.) certain specific compounds of the invention contain both basic and acidic functional groups that convert the compound to a base or acid addition salt.

Thus, the compounds of the present invention may exist in the form of a salt, such as a salt with a pharmaceutically acceptable acid. The present invention encompasses such salts. Non-limiting examples of such salts include hydrochloride, hydrobromide, phosphate, sulfate, methanesulfonate, nitrate, maleate, acetate, citrate, fumarate, propionate, tartrate (e.g., (+) -tartrate, (-) -tartrate, or mixtures thereof comprising racemic mixtures), succinate, benzoate, and salts formed with amino acids such as glutamic acid and quaternary ammonium salts (e.g., methyl iodide, ethyl iodide, etc.). These salts can be prepared by methods known to those skilled in the art.

The neutral form of the compound is preferably regenerated by contacting the salt with a base or acid and isolating the parent compound in a conventional manner. The parent form of the compound may differ from the various salt forms by certain physical characteristics, such as solubility in polar solvents.

In addition to salt forms, the present invention provides compounds in prodrug form. Prodrugs of the compounds described herein are those compounds that readily undergo chemical changes under physiological conditions to provide the compounds of the present invention. Prodrugs of the compounds described herein may be converted in vivo after administration. In addition, prodrugs can be converted to the compounds of the present invention in an ex vivo environment by chemical or biochemical means, for example, when contacted with a suitable enzyme or chemical reagent.

Certain compounds of the present invention may exist in unsolvated forms as well as solvated forms, including hydrated forms. In general, the solvated forms are equivalent to unsolvated forms and are intended to be encompassed within the scope of the present invention. Certain compounds of the present invention may exist in a variety of crystalline or amorphous forms. In general, all physical forms are equivalent for the uses contemplated by the present invention and are intended to be within the scope of the present invention.

"pharmaceutically acceptable excipient" and "pharmaceutically acceptable carrier" refer to a substance that facilitates administration and absorption of an active agent to a subject, and may be included in the compositions of the present invention without causing a significant adverse toxicological effect to the patient. Non-limiting examples of pharmaceutically acceptable excipients include water, NaCl, standard saline solution, lactated Ringer's solution, common sucrose, common glucose, binders, fillers, disintegrants, lubricants, coatings, sweeteners, flavors, salt solutions (e.g., Ringer's solution), alcohols, oils, gelatin, carbohydrates (e.g., lactose, amylose, or starch), fatty acid esters, hydroxymethylcellulose, polyvinylpyrrolidine, pigments, and the like. Such preparations can be sterilized and, if desired, mixed with auxiliary agents which do not deleteriously react with the compounds of the invention, such as lubricants, preservatives, stabilizers, wetting agents, emulsifiers, salts for influencing osmotic pressure, buffers, coloring and/or perfuming substances, etc. One skilled in the art will recognize that other pharmaceutical excipients are suitable for use in the present invention.

The term "preparing" is intended to encompass formulating the active compound as an encapsulating material with a carrier, resulting in a capsule in which the active component, with or without other carriers, is surrounded by, and thus associated with, the carrier. Similarly, cachets and lozenges were included. Lozenges, powders, capsules, pills, cachets, and troches can be used as solid dosage forms suitable for oral administration.

An "adenosine A2B receptor inhibitor" refers to a compound (e.g., a compound described herein) that reduces the activity of the adenosine A2B receptor when compared to a control, such as in the absence of the compound or a compound known to be inactive. An "adenosine A2A receptor inhibitor" refers to a compound (e.g., a compound described herein) that reduces the activity of the adenosine A2A receptor when compared to a control, such as in the absence of the compound or a compound known to be inactive. An adenosine A2B receptor inhibitor can preferentially bind to the adenosine A2B receptor (i.e., an adenosine A2B receptor inhibitor inhibits adenosine A2B receptor activity, more than an adenosine A2B receptor inhibitor inhibits a different adenosine receptor (e.g., A2A, a1, or A3)).

"contacting" is used in accordance with its ordinary meaning and refers to the process of bringing at least two different species (e.g., chemical compounds comprising biomolecules, or cells) into sufficient proximity to react, interact, or physically touch. However, it will be appreciated that the resulting reaction product may be produced directly from the reaction between the added reagents or from an intermediate from one or more of the added reagents, which may be produced in the reaction mixture.

The term "contacting" may comprise reacting, interacting or physically touching two species, wherein the two species may be a compound and a protein or enzyme as described herein. In some embodiments, contacting comprises interacting a compound described herein with a protein or enzyme involved in the signal transduction pathway.

As defined herein, with reference to a protein, the term "activation/activate/activating, etc." refers to the conversion of a protein from an initial inactive or inactivated state to a biologically active derivative. The term refers to a protein whose activation (activation) or causes it to activate (activating), sensitize or up-regulate signal transduction or enzymatic activity or the amount of the protein, which is reduced in a disease.

As defined herein, the term "activation/active/activating/activator, etc." in reference to a protein-inhibitor interaction means that the activity or function of a protein is positively affected (e.g., increased) relative to the activity or function of the protein in the absence of an activator. In embodiments, activation means positively affecting (e.g., increasing) the concentration or level of protein relative to the concentration or level of protein in the absence of the activating agent. The terms may refer to activation of a protein or causing activation of a protein (activation), sensitizing, or up-regulating signal transduction, or enzymatic activity, or an amount of the protein, which is decreased in a disease-thus, activation may comprise, at least in part, partially or completely increasing stimulation, increasing activation, or causing activation of a protein associated with a disease (e.g., a protein decreased in a disease relative to a non-diseased control), sensitizing, or up-regulating signal transduction, or enzymatic activity, or an amount of the protein. Activation may comprise at least partially or completely increasing stimulation of the protein, increasing activation or causing activation thereof (sensitization activation), sensitizing or up-regulating signal transduction or enzymatic activity or the amount of the protein. The terms "agonist," "activator," "upregulator" and the like refer to a substance that is capable of detectably increasing the expression or activity of a given gene or protein relative to the absence of the agonist. The agonist can increase expression or activity by 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or more compared to a control in the absence of agonist. In certain instances, the expression or activity is 1.5-fold, 2-fold, 3-fold, 4-fold, 5-fold, 10-fold or more greater than the expression or activity in the absence of an agonist.

As defined herein, the term "inhibit (inhibition/inhibiting, etc.)" with reference to protein-inhibitor interactions means negatively affecting (e.g., decreasing) the activity or function of a protein relative to the activity or function of a protein in the absence of an inhibitor. In embodiments, inhibiting means negatively affecting (e.g., reducing) the concentration or level of the protein relative to the concentration or level of the protein in the absence of the inhibitor. In embodiments, inhibition refers to a reduction in a disease or symptom of a disease. In embodiments, inhibition refers to a decrease in the activity of a particular protein target. Thus, inhibiting comprises at least partially or completely blocking the stimulation of the protein, reducing, preventing or delaying activation, or inactivating, desensitizing, or down-regulating signal transduction or enzymatic activity or the amount of said protein. In embodiments, inhibition refers to a reduction in the activity of a target protein caused by a direct interaction (e.g., binding of an inhibitor to the target protein). In embodiments, inhibition refers to a decrease in the activity of a protein of interest due to an indirect interaction (e.g., binding of an inhibitor to a protein that activates the protein of interest, thereby preventing activation of the protein of interest). An "adenosine A2B receptor inhibitor" is a compound that negatively affects (e.g., reduces) the activity or function of the adenosine A2B receptor relative to the activity or function of the adenosine A2B receptor in the absence of the inhibitor. An "adenosine A2A receptor inhibitor" is a compound that negatively affects (e.g., reduces) the activity or function of the adenosine A2A receptor relative to the activity or function of the adenosine A2A receptor in the absence of the inhibitor.

The terms "inhibitor", "repressor" or "antagonist" or "downregulator" interchangeably refer to a substance capable of detectably reducing the expression or activity of a given gene or protein. An antagonist can reduce expression or activity by 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or more compared to a control in the absence of the antagonist. In certain instances, the expression or activity is 1.5-fold, 2-fold, 3-fold, 4-fold, 5-fold, 10-fold or less lower than the expression or activity in the absence of the antagonist.

The terms "adenosine A2A receptor" and "AA 2A receptor" and "A2A" and "ADORA 2A" refer to proteins (including homologs, isoforms and functional fragments thereof) having adenylate cyclase activity. The term encompasses any recombinant or naturally occurring variant form of the adenosine A2A receptor thereof that maintains adenosine A2A receptor activity (e.g., within at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, or 100% activity compared to the wild-type adenosine A2A receptor). In embodiments, the adenosine A2A receptor protein encoded by the ADORA2A gene has an amino acid sequence set forth in or corresponding to Entrez 135, UniProt P29274, or RefSeq (protein) NP _ 000666. In embodiments, the ADORA2A gene has a nucleic acid sequence set forth in refseq (mrna) NM _000675. In embodiments, the amino acid sequence or nucleic acid sequence is a sequence known at the time of filing the present application. In an embodiment, the sequence corresponds to GI: 156142194. in an embodiment, the sequence corresponds to NM _ 000675.5. In an embodiment, the sequence corresponds to NP _ 000667.2. In an embodiment, the sequence corresponds to GI: 4501949. in the examples, the A2A protein corresponds to the sequence:

MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS(SEQ ID NO:1)

the terms "adenosine A2B receptor" and "AA 2B receptor" and "A2B" and "ADORA 2B" refer to proteins (including homologs, isoforms and functional fragments thereof) having adenylate cyclase activity. The term encompasses any recombinant or naturally occurring variant form of the adenosine A2B receptor thereof that maintains adenosine A2B receptor activity (e.g., within at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, or 100% activity compared to the wild-type adenosine A2B receptor). In an embodiment, the adenosine A2B receptor protein encoded by the ADORA2B gene has an amino acid sequence set forth in or corresponding to Entrez 136, UniProt P29275 or RefSeq (protein) NP _000667. In embodiments, the ADORA2B gene has a nucleic acid sequence set forth in refseq (mrna) NM _000676. In embodiments, the amino acid sequence or nucleic acid sequence is a sequence known at the time of filing the present application. In an embodiment, the sequence corresponds to GI: 4501950. in an embodiment, the sequence corresponds to NM _ 000676.2. In an embodiment, the sequence corresponds to NP _ 000667.1. In the examples, the A2B protein corresponds to the sequence:

MLLETQDALYVALELVIAALSVAGNVLVCAAVGTANTLQTPTNYFLVSLAAADVAVGLFAIPFAITISLGFCTDFYGCLFLACFVLVLTQSSIFSLLAVAVDRYLAICVPLRYKSLVTGTRARGVIAVLWVLAFGIGLTPFLGWNSKDSATNNCTEPWDGTTNESCCLVKCLFENVVPMSYMVYFNFFGCVLPPLLIMLVIYIKIFLVACRQLQRTELMDHSRTTLQREIHAAKSLAMIVGIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHANSVVNPIVYAYRNRDFRYTFHKIISRYLLCQADVKSGNGQAGVQPALGVGL(SEQ ID NO:2)。

the terms "adenosine a1 receptor" and "a 1 receptor" refer to proteins (including homologs, isoforms, and functional fragments thereof) having adenylate cyclase activity. The term encompasses any recombinant or naturally occurring variant form of the adenosine a1 receptor thereof that maintains adenosine a1 receptor activity (e.g., within at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, or 100% activity compared to the wild-type adenosine a1 receptor). In an example, the adenosine a1 receptor protein encoded by the ADORA1 gene has an amino acid sequence set forth in or corresponding to Entrez 134, UniProt P30542 or RefSeq (protein) NP _ 000665. In embodiments, the ADORA1 gene has the nucleic acid sequence set forth in refseq (mrna) NM _ 000674. In embodiments, the amino acid sequence or nucleic acid sequence is a sequence known at the time of filing the present application.

The terms "adenosine A3 receptor" and "A3 receptor" refer to proteins (including homologs, isoforms, and functional fragments thereof) having adenylate cyclase activity. The term encompasses any recombinant or naturally occurring variant form of the adenosine A3 receptor thereof that maintains adenosine A3 receptor activity (e.g., within at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, or 100% activity compared to the wild-type adenosine A3 receptor). In embodiments, the adenosine A3 receptor protein encoded by the ADORA3 gene has an amino acid sequence set forth in or corresponding to Entrez140, UniProt P0DMS8, or RefSeq (protein) NP _ 000668. In an embodiment, the ADORA3 gene has the nucleic acid sequence set forth in refseq (mrna) NM — 000677. In embodiments, the amino acid sequence or nucleic acid sequence is a sequence known at the time of filing the present application.

The term "expression" encompasses any step involved in the production of a polypeptide, including, but not limited to, transcription, post-transcriptional modification, translation, post-translational modification, and secretion. Expression can be detected using conventional techniques for detecting proteins (e.g., ELISA, western blot, flow cytometry, immunofluorescence, immunohistochemistry, etc.).

The term "disease" or "condition" refers to a state or health condition of a patient or individual that can be treated with a compound or method provided herein. The disease may be cancer. The disease may be an autoimmune disease. The disease may be a fibrotic disorder (e.g., fibrosis). The disease may be an inflammatory disease. The disease may be a neurodegenerative disease. In some other examples, "cancer" refers to human cancers and carcinomas, sarcomas, adenocarcinomas, lymphomas, leukemias, and the like, including solid and lymphocytic cancers, kidney, breast, lung, bladder, colon, ovary, prostate, pancreas, stomach, brain, head and neck, skin, uterus, testis, glioma, esophageal, and liver cancers (including hepatomas), lymphomas (including acute B lymphoblastic lymphomas), non-Hodgkin's (Hodgkin's) lymphomas (e.g., Burkitt's, small cell, and large cell lymphomas), Hodgkin's lymphomas, leukemias (including AML, ALL, and CML), or multiple myeloma.

As used herein, the term "cancer" refers to all types of cancers, neoplasms or malignancies found in mammals (e.g., humans), including leukemias, lymphomas, carcinomas and sarcomas. Exemplary cancers that can be treated with the compounds or methods provided herein include brain cancer, glioma, glioblastoma, neuroblastoma, prostate cancer, colorectal cancer, pancreatic cancer, cervical cancer, gastric cancer, ovarian cancer, lung cancer, and head cancer. Exemplary cancers that can be treated with the compounds or methods provided herein include: thyroid cancer, cancer of the endocrine system, brain cancer, breast cancer, cervical cancer, colon cancer, head and neck cancer, liver cancer, kidney cancer, lung cancer, non-small cell lung cancer, melanoma, mesothelioma, ovarian cancer, sarcoma, gastric cancer, uterine cancer, neural tube blastoma, colorectal cancer, pancreatic cancer. Other examples include: hodgkin's disease, non-hodgkin's lymphoma, multiple myeloma, neuroblastoma, glioma, glioblastoma multiforme, ovarian cancer, rhabdomyosarcoma, primary thrombocythemia, primary macroglobulinemia, primary brain tumor, cancer, malignant pancreatic cancer, malignant carcinoid cancer, bladder cancer, precancerous skin lesion, testicular cancer, lymphoma, thyroid cancer, neuroblastoma, esophageal cancer, genitourinary tract cancer, malignant hypercalcemia, endometrial cancer, adrenal cortex cancer, neoplasms of the endocrine or exocrine pancreas, medullary thyroid cancer, melanoma, colorectal cancer, papillary thyroid cancer, hepatocellular carcinoma, or prostate cancer.

The term "leukemia" broadly refers to a progressive malignant disease of the blood-forming organs and is generally characterized by the distorted proliferation and development of leukocytes and their precursors in the blood and bone marrow. Leukemias are generally clinically classified based on: (1) duration and character of acute or chronic disease; (2) the cell type involved; bone marrow (myelogenous), lymphocytic (lymphoid) or monocytic; and (3) an increase or no increase in the number of abnormal cells in the blood of leukemia or leukopenia (sub-leukemia). Exemplary leukemias that can be treated with the compounds or methods provided herein include, for example: acute non-lymphocytic leukemia, chronic lymphocytic leukemia, acute myelocytic leukemia, chronic myelocytic leukemia, acute promyelocytic leukemia, adult T-cell leukemia, leukemia deficient in leukemia, basophilic leukemia, blastic leukemia, bovine leukemia, chronic myelocytic leukemia, skin leukemia, embryonic leukemia, eosinophilic leukemia, murine leukemia, hairy cell leukemia, hemoblastic leukemia, hemablastic leukemia, histiocytic leukemia, stem cell leukemia, acute monocytic leukemia, leukopenic leukemia, lymphoid leukemia, lymphoblastic leukemia, lymphocytic leukemia, lymphoid leukemia, lymphosarcoma cell leukemia, mast cell leukemia, megakaryocytic leukemia, human, Small myeloblastic leukemia, monocytic leukemia, myeloblastic leukemia, myelocytic leukemia, myeloblastic leukemia, myelomyeloblastic leukemia, myelomonocytic leukemia, Neglel leukemia (Naegeleukemia), plasma cell leukemia, multiple myeloma, plasma cell leukemia, promyelocytic leukemia, Reed's (Rieder) cell leukemia, Hill's leukemia, stem cell leukemia, sub-leukemia or undifferentiated cell leukemia.

As used herein, the term "lymphoma" refers to a type of cancer that affects both hematopoietic and lymphoid tissues. It begins with lymphocytes; found primarily in blood cells in the lymph nodes, spleen, thymus and bone marrow. The two major types of lymphoma are non-hodgkin's lymphoma and hodgkin's disease. Hodgkin's disease represents approximately 15% of all diagnosed lymphomas. This is a cancer associated with Reed-Sternberg malignant B lymphocytes (Reed-Sternberg malignant B lymphocytes). Non-Hodgkin's lymphomas (NHL) can be classified based on the rate of cancer growth and the cell types involved. Aggressive (higher) and indolent (lower) NHL types exist. Based on the cell type involved, there are B-cells and T-cells NHL. Exemplary B-cell lymphomas that can be treated with the compounds or methods provided herein include, but are not limited to, small lymphocytic lymphoma, mantle cell lymphoma, follicular lymphoma, marginal zone lymphoma, extranodal (MALT) lymphoma, nodal (mononuclear B cell) lymphoma, splenic lymphoma, diffuse large cell B lymphoma, burkitt's lymphoma, lymphoblastic lymphoma, immunoblastic large cell lymphoma, or precursor B-lymphoblastic lymphoma. Exemplary T cell lymphomas that can be treated with the compounds or methods provided herein include, but are not limited to, cutaneous T cell lymphoma, peripheral T cell lymphoma, large cell lymphoma multiforme, mycosis fungoides, and precursor T-lymphoid cell lymphoma.

The term "sarcoma" generally refers to a tumor that is composed of a substance such as embryonic connective tissue and generally includes tightly packed cells embedded in a fibrous or homogeneous substance. Sarcomas that can be treated with the compounds or methods provided herein comprise: chondrosarcoma, fibrosarcoma, lymphosarcoma, melanoma, myxosarcoma, osteosarcoma, Abelmoschi sarcoma (Abemethyl ' ssarcoma), liposarcoma, alveolar soft tissue tumor, amelogenic sarcoma, botryoid sarcoma, chloromonosarcoma, choriocarcinoma, embryosarcoma, Wilms ' tumor (Wilms ' sarcoma), endometrioma, stromal tumor, Ewing's sarcoma, myosarcoma, fibrosarcoma, giant cell sarcoma, granulocytic sarcoma, Hodgkin's sarcoma, idiopathic polychrome sarcoma, B-cell immunoblastic sarcoma, lymphoma, T-cell immunoblastic sarcoma, Jensen's sarcoma, Kaposi's sarcoma, Kupffer cell sarcoma (Kupffer cell sarcoma), angiosarcoma, white sarcoma, desmoplastic sarcoma, osteosarcoma, Abelmoschi sarcoma, osteosarcoma, Abelmoschi's sarcoma, liposarcoma, and Epstein-Barr's sarcoma, Reticulocytic sarcoma, Rous sarcoma (Rous sarcoma), serous (serositic) sarcoma, synovial sarcoma, or capillary-expansive sarcoma.

The term "melanoma" refers to tumors produced by the melanocytic system of the skin and other organs. Melanoma that may be treated with the compounds or methods provided herein include, for example: acral freckle melanoma, leucoma, benign juvenile melanoma, cloudlan melanoma (Cloudman' S melanoma), S91 melanoma, hadrine-paschen melanoma (Harding-Passey melanoma), juvenile melanoma, lentigo melanoma, malignant nodular melanoma, scrotal melanoma, or superficial spreading melanoma.

The term "carcinoma" refers to a malignant new growth made up of epithelial cells that tends to infiltrate the surrounding tissues and cause metastasis of the cancer. Exemplary carcinomas that can be treated with the compounds or methods provided herein include, for example: medullary thyroid carcinoma, familial medullary thyroid carcinoma, acinar carcinoma, alveolar carcinoma, adenoid cystic carcinoma (adenocystic carcinoma), adenoid cystic carcinoma (adenoid cystic carcinoma), adenocarcinoma, adrenocortical carcinoma, alveolar cell carcinoma, basal-like cytoma, basal-like carcinoma, basal squamous cell carcinoma, bronchioloalveolar carcinoma, bronchiolobronchial carcinoma, bronchial carcinoma, cerebroma, cholangiocellular carcinoma, choriocarcinoma, jelly-like carcinoma, acne carcinoma, uterine corpus carcinoma, ethmoid carcinoma, armor-like carcinoma, skin carcinoma, columnar cell carcinoma, tubular carcinoma, hard carcinoma, embryonic carcinoma, medullary carcinoma, epidermoid carcinoma, adenoid epithelial carcinoma, explanted carcinoma, ulcerative carcinoma, fibrocarcinoma, gelatininiformenia carcinoma, glioma, giant cell carcinoma, granuloma, adenocarcinoma, stratified cell carcinoma, maternal cell carcinoma, schlecular cell carcinoma, polycystic cell carcinoma (hepatocellular carcinoma), choriocarcinoma, squamous cell carcinoma, and squamous cell carcinoma (hepatocellular carcinoma), squamous cell carcinoma (hepatocellular carcinoma), squamous cell carcinoma, squamous cell, Hyaluronan cancer, adrenocarcinoid tumor, juvenile embryonal carcinoma, carcinoma in situ, carcinoma in epidermis, carcinoma in epithelium, Klompecher's carcinoma, Kulchitzky-cell carcinoma, large cell carcinoma, lenticular carcinoma, lipomatoid carcinoma, lymphatic epithelial carcinoma, medullary carcinoma, melanoma, soft carcinoma, mucinous cell carcinoma, mucoepidermoid carcinoma, mucinous-like carcinoma, nasopharyngeal carcinoma, oat cell carcinoma, ossified carcinoma, sclerotic-like carcinoma, papillary carcinoma, periportal carcinoma, invasive carcinoma, echinocytic carcinoma, limphoid carcinoma, renal tumor cell carcinoma, storage cell carcinoma, schciencoderma, cinoma (genital-like carcinoma), genital cell carcinoma, polima, simple potato cell carcinoma, or small-like carcinoma, simply A globular cell cancer, a spindle cell cancer, a medullary cancer, a squamous cell cancer, a tethered cancer, a vasodilatory cancer, a transitional cell cancer, a nodular skin cancer, a warty cancer, or a choriocarcinoma.

The term "treatment" refers to any indication of successful treatment or amelioration of an injury, disease, pathology, or condition, including any objective or subjective parameter, such as elimination; (iii) alleviating; reduce symptoms or make injuries, pathologies, or conditions more tolerable to the patient; slowing the rate of degeneration or decline; making the final denaturation point less debilitating; or improving the physical and mental health of the patient. Treatment or amelioration of symptoms can be based on objective or subjective parameters; including results of physical examination, neuropsychiatric examination, and/or mental evaluation. The term "treating" and morphological changes thereof can include preventing an injury, pathology, condition, or disease. In an embodiment, the treatment is prophylaxis. In embodiments, the treatment does not comprise prophylaxis.

As used herein, "treatment" (and as is well understood in the art) also broadly encompasses any method for obtaining a beneficial or desired result, including a clinical result, in a condition of an individual. Beneficial or desired clinical results can include, but are not limited to, alleviation or amelioration of one or more symptoms or conditions, diminishment of extent of disease, stabilization (i.e., not worsening) of disease state, prevention of disease metastasis or spread, delay or slowing of disease progression, amelioration or palliation of the disease state, diminishment of disease recurrence, and remission, whether partial or complete and whether detectable or undetectable. In other words, "treatment" as used herein encompasses any cure, amelioration or prevention of a disease. Treatment can prevent disease occurrence; inhibiting the spread of disease; alleviating the symptoms of the disease; completely or partially remove the underlying cause of the disease; shortening the duration of the disease; or a combination of these. As used herein, "treatment" includes prophylactic treatment. The method of treatment comprises administering to the subject a therapeutically effective amount of the active agent. The step of administering may consist of a single administration, or may comprise a series of administrations. The length of treatment depends on a variety of factors, such as the severity of the condition, the age of the patient, the concentration of the active agent, the activity of the composition used in the treatment, or a combination thereof. It will also be appreciated that the effective dose of the agent used for treatment or prophylaxis can be increased or decreased over a particular course of treatment or prophylaxis regimen. Dose variation can result and become apparent by standard diagnostic assays known in the art. In some cases, long-term administration may be required. For example, the composition is administered to an individual in an amount sufficient to treat the patient for a sufficient time.

The term "preventing" refers to reducing the occurrence of a disease or disease symptom in a patient (e.g., an adenosine A2B receptor or adenosine A2A receptor-related disease or disease symptom in a patient). As indicated above, prevention may be complete (no detectable symptoms) or partial, such that fewer symptoms are observed or the severity of symptoms is reduced than would be possible without treatment.

"patient" or "subject in need thereof" refers to a living organism suffering from or predisposed to a disease or condition that can be treated by administration of a pharmaceutical composition as provided herein. Non-limiting examples include humans, other mammals, bovines, rats, mice, dogs, monkeys, goats, sheep, cattle, deer, and other non-mammals. In some embodiments, the patient is a human.

An "effective amount" is an amount of a compound sufficient to achieve the stated purpose (e.g., achieve its effect of administration, treat a disease, reduce enzyme activity, increase enzyme activity, decrease signaling pathways, or decrease one or more symptoms of a disease or condition) relative to the absence of the compound. An example of an "effective amount" is an amount sufficient to cause treatment, prevention, or reduction of one or more symptoms of a disease, which may also be referred to as a "therapeutically effective amount". "reducing" one or more symptoms (and grammatical equivalents of this phrase) means reducing the severity or frequency of the symptoms, or eliminating the symptoms. A "prophylactically effective amount" of a drug is an amount that will have the desired prophylactic effect when the drug is administered to an individual, e.g., to prevent or delay the onset (or recurrence) of an injury, disease, pathology, or condition, or to reduce the likelihood of the onset (or recurrence) of an injury, disease, pathology, or condition, or a symptom thereof. The full prophylactic effect does not necessarily occur by administration of one dose, and may occur after administration of only a series of doses. Thus, a prophylactically effective amount may be administered in one or more administrations. As used herein, "activity-reducing amount" refers to the amount of antagonist required to reduce the enzymatic activity relative to the absence of the antagonist. As used herein, "functionally disrupting amount" refers to the amount of antagonist required to disrupt the function of an enzyme or protein relative to the absence of the antagonist. The precise amount will depend on The purpose of The treatment and will be determined by those skilled in The Art using known techniques (see, e.g., Lieberman, Pharmaceutical Dosage Forms (volumes 1-3, 1992); Lloyd, Art, Science and Technology in Pharmaceutical Compounding (The Art, Science and Technology in Pharmaceutical Compounding (1999); Pickar dose calculation (Dosage Calculations) (1999) and Remington, Pharmaceutical Science and Practice (Remington: The Science and Practice of pharmacy), 20 th edition, 2003, Gennaro edition, Lippincott, Williams & Wilkins).

For any of the compounds described herein, a therapeutically effective amount can be initially determined according to cell culture analysis. The target concentration will be the concentration of active compound that is capable of achieving the methods described herein, as measured using the methods described herein or known in the art.

As is well known in the art, a therapeutically effective amount for use in humans can also be determined from animal models. For example, the doses useful in humans are formulated to achieve concentrations found to be effective in animals. The dosage in humans can be adjusted by monitoring the effect of the compound and adjusting the dosage up or down as described above. Adjusting the dose to achieve maximal efficacy in humans based on the methods described above and other methods is well within the ability of one of ordinary skill in the art.

The term "therapeutically effective amount" as used herein means an amount of a therapeutic agent sufficient to ameliorate a condition, as described above. For example, for a given parameter, a therapeutically effective amount will show an increase or decrease of at least 5%, 10%, 15%, 20%, 25%, 40%, 50%, 60%, 75%, 80%, 90%, or at least 100%. Therapeutic efficacy may also be expressed as a "fold" increase or decrease. For example, a therapeutically effective amount can have an effect of at least 1.2-fold, 1.5-fold, 2-fold, 5-fold, or more relative to a control.

The dosage may vary depending on the requirements of the patient and the compound employed. In the context of the present invention, the dose administered to a patient should be sufficient to achieve a beneficial therapeutic response in the patient over time. The size of the dose will also be determined by the presence, nature and extent of any adverse side effects. The determination of the appropriate dosage for a particular situation is within the skill of the physician. Generally, treatment is initiated at a dose that is less than the optimal dose of the compound. Thereafter, the dose is increased in small increments until the optimum effect under these circumstances is achieved. The dose and interval may be independently adjusted to achieve levels of the administered compound that are effective for the particular clinical indication being treated. This will provide a treatment regimen commensurate with the severity of the disease condition in the individual.

As used herein, the term "administering" means orally administering to a subject, in the form of a suppository, topically contacting, intravenously, intraperitoneally, intramuscularly, intralesionally, intrathecally, intranasally, or subcutaneously, or implanting a slow release device (e.g., a mini osmotic pump). Administration is by any route compatible with the formulation, including parenteral and transmucosal (e.g., buccal, sublingual, palatine, gingival, nasal, vaginal, rectal, or transdermal). Parenteral administration includes, for example, intravenous, intramuscular, intraarteriolar, intradermal, subcutaneous, intraperitoneal, intracerebroventricular, and intracranial. Other modes of delivery include, but are not limited to, the use of liposome formulations, intravenous infusion, transdermal patches, and the like.

By "co-administration" it is meant that the compositions described herein are administered simultaneously with, just before, or just after the administration of one or more additional therapies. The compounds of the invention may be administered alone or may be co-administered to a patient. Co-administration is meant to encompass the simultaneous or sequential administration of the compound(s), either alone or in combination. Thus, the formulations may also be combined with other active substances (e.g. to reduce metabolic degradation) when desired. The compositions of the present invention may be delivered transdermally, by a topical route, or formulated as application sticks, solutions, suspensions, emulsions, gels, creams, ointments, pastes, jellies, paints, powders, and aerosols.

As used herein, "cell" refers to a cell that performs a metabolic or other function sufficient to maintain or replicate its genomic DNA. Cells can be identified by methods well known in the art, including, for example, the presence of an intact membrane, staining with a particular dye, being capable of producing progeny, or in the case of a gamete being capable of combining with a second gamete to produce a live progeny. The cells may comprise prokaryotic and eukaryotic cells. Prokaryotic cells include, but are not limited to, bacteria. Eukaryotic cells include, but are not limited to, yeast cells and cells derived from plants and animals, such as mammalian, insect (e.g., noctuid), and human cells. It may be suitable when the cells are naturally non-adherent or have been treated (e.g., by trypsinization) so as not to adhere to the surface.

"control" or "control experiment" is used in its ordinary sense and refers to an experiment in which the individual or reagents of the experiment are treated as in a parallel experiment, except that the procedures, reagents, or variables of the experiment are omitted. In some cases, a control is used as a standard for comparison in evaluating the effect of an experiment. In some embodiments, a control is a measure of protein activity in the absence of a compound as described herein (including examples and examples).

The term "modulator" refers to a composition that increases or decreases the level of a target molecule or the function of a target molecule or the physical state of a target of a molecule. In some embodiments, the adenosine A2B receptor or adenosine A2A receptor-related disease modulator is a compound that reduces the severity of one or more symptoms of a disease (e.g., cancer) associated with the adenosine A2B receptor or the adenosine A2A receptor. An adenosine A2B receptor or adenosine A2A receptor modulator is a compound that increases or decreases the activity or function or level of activity or function of the adenosine A2B receptor or adenosine A2A receptor relative to the activity or function or level of activity or function of the adenosine A2B receptor or adenosine A2A receptor in the absence of the adenosine A2B receptor or adenosine A2A receptor modulator.

The term "modulate" is used in accordance with its ordinary meaning and is meant to act to alter or change one or more characteristics. "Modulation" refers to a method of altering or changing one or more characteristics. For example, as applied to the effect of a modulator on a target protein, modulation means alteration by increasing or decreasing the identity or function of the target molecule, or the amount of the target molecule.

In the context of a substance or substance activity or function associated with a disease (e.g., a protein-related disease, a cancer associated with adenosine A2B receptor activity, an adenosine A2B receptor-related cancer, an adenosine A2B receptor-related disease (e.g., cancer)), the term "associated with" or "associated with …" means that the disease (e.g., cancer) is caused (in whole or in part) by the substance or substance activity or function, or that a symptom of the disease is caused (in whole or in part) by the substance or substance activity or function. For example, a cancer associated with adenosine A2B receptor or adenosine A2A receptor activity or function may be a cancer arising (in whole or in part) from aberrant adenosine A2B receptor or adenosine A2A receptor function (e.g., enzymatic activity, protein-protein interactions, signaling pathways), or wherein a particular symptom of a disease is a cancer arising (in whole or in part) from aberrant adenosine A2B receptor or adenosine A2A receptor activity or function. As used herein, a pathogen is described as being associated with a disease if it can be the target of treatment of the disease. For example, in instances where increasing adenosine A2B receptor or adenosine A2A receptor activity or function (e.g., signaling pathway activity) results in a disease (e.g., cancer), a cancer associated with adenosine A2B receptor or adenosine A2A receptor activity or function or an adenosine A2B receptor or adenosine A2A receptor-associated disease (e.g., cancer) may be treated with an adenosine A2B receptor or adenosine A2A receptor modulator or adenosine A2B receptor or adenosine A2A receptor inhibitor.

As used herein, the term "abnormal" refers to something other than normal. When used to describe enzymatic activity or protein function, abnormal refers to an activity or function that is higher or lower than the average of normal control or normal non-diseased control samples. Abnormal activity can refer to an amount of activity that causes a disease, wherein returning abnormal activity to normal or a non-disease related amount (e.g., by administering a compound as described herein or using a method as described herein) causes a reduction in the disease or one or more symptoms of the disease.

As used herein, the term "signaling pathway" refers to a series of interactions between cellular components and optionally extracellular components (e.g., proteins, nucleic acids, small molecules, ions, lipids) that transmit changes in one component to one or more other components, which in turn may transmit changes to additional components, which optionally propagate to other signaling pathway components. For example, binding of an adenosine A2B receptor or an adenosine A2A receptor to a compound as described herein may reduce the level of a product of a reaction catalyzed by the adenosine A2B receptor or the adenosine A2A receptor or a downstream derivative of such a product, or binding may reduce the interaction between the adenosine A2B receptor or the adenosine A2A receptor or the adenosine A2B receptor or the adenosine A2A receptor reaction product and a downstream effector or signaling pathway component, thereby causing a change in cell growth, proliferation or survival.

As used herein, the term "fibrosis" refers to the formation of excess fibrous connective tissue. The term "fibrotic disease" refers to a disease or condition caused by abnormal fibrosis, or in which the symptoms are abnormal fibrosis (e.g., relative to a control individual without the disease). Examples of fibrotic diseases that may be treated with the compounds, pharmaceutical compositions or methods described herein include Idiopathic Pulmonary Fibrosis (IPF), myocardial infarction, myocardial hypertrophy, heart failure, cirrhosis, acetaminophen (Tylenol) hepatotoxicity, hepatitis C liver disease, fatty liver (hepatosteatosis/fatty liver disease), and liver fibrosis.

As used herein, the term "neurodegenerative disease" refers to a disease or condition in which the function of the nervous system of an individual is weakened (e.g., relative to a control individual not suffering from neurodegenerative disease). Examples of neurodegenerative diseases that can be treated with the compounds, pharmaceutical compositions, or methods described herein include: alexander's disease, Epstein-Barr's disease, Alzheimer's disease, amyotrophic lateral sclerosis, ataxia telangiectasia, Pasteur's disease (also known as Scheimer-Vogt-Sjogren-Batten disease), Bovine spongiform encephalopathy (Bovine spongiform encephalopathy; BSE), Karma disease (Canavan disease), Cockayne syndrome, corticobasal degeneration, Creutzfeldt-Jakob disease, temporal dementia, Gerstmann-Straussler syndrome (Gerstmann-Straussler-Scheinker)

-Scheinker syndrome), Huntington's disease, HIV-associated dementia, Kennedy's disease, Krabbe's disease, kuru (kuru), Lewy body dementia (Lewy body division), macyoto-Joseph disease (spinocerebellar type 3), multiple sclerosisChemosis, multiple systemic atrophy, narcolepsy, Neurobreiosis, Parkinson's Disease, Pemeus-Merzbacher Disease, Pick's Disease, primary lateral sclerosis, prion Disease, Refsum's Disease, Sandhoff's Disease, Schlder's Disease, subacute combined degeneration of subacute spinal cord secondary to pernicious anemia, schizophrenia, spinocerebellar disorders (of various types with different characteristics), spinal muscular atrophy, Spirot-Richardson-Olszewski Disease, WolRam Syndrome, transverse myelitis, Marchot-Mariothis, or tuberculosis. Examples of neurodegenerative diseases that can be treated with the compounds, pharmaceutical compositions, or methods described herein include: retinitis pigmentosa, amyotrophic lateral sclerosis, retinal degeneration, macular degeneration, Parkinson's disease, Alzheimer's disease, Huntington's disease, prion disease, Creutzfeldt-Jakob disease, or Kuru.

II. Compound

In one aspect, a compound is provided having the formula:

L¹is a bond, substituted or unsubstituted alkylene, or substituted or unsubstituted heteroalkylene. In the examples, L¹Is substituted or unsubstituted C₁-C₃Alkylene or substituted or unsubstituted 2-to 3-membered heteroalkylene. Ring a is aryl or heteroaryl. R¹Independently of one another is halogen, -CX¹ ₃、-CHX¹ ₂、-CH₂X¹、-OCX¹ ₃、-OCH₂X¹、-OCHX¹ ₂、-CN、-SR^1D、-NR^1AR^1B、-C(O)R^1C、-C(O)OR^1C、-C(O)NR^1AR^1B、-OR^1D、-NR^1AC(O)R^1C、-NR^1AC(O)OR^1C、-SO₂R^1D、-SO₂NR^1AR^1B、-NR^1ASO₂R^1DSubstituted or unsubstituted alkyl or substituted or unsubstituted heteroalkyl. The symbol z1 is an integer from 0 to 5.

R²Independently hydrogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. R³Independently hydrogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. R²And R³May optionally be joined to form a substituted or unsubstituted heterocycloalkyl group.

R⁴Independently hydrogen, halogen, -CX⁴ ₃、-CHX⁴ ₂、-CH₂X⁴、-OCX⁴ ₃、-OCH₂X⁴、-OCHX⁴ ₂、-CN、-SR^4D、-NR^4AR^4B、-C(O)R^4C、-C(O)OR^4C、-C(O)NR^4AR^4B、-OR^4D、-NR^4AC(O)R^4C、-NR^4AC(O)OR^4CSubstituted or unsubstituted alkyl or substituted or unsubstituted heteroalkyl. R⁵Independently hydrogen, halogen, -CX⁵ ₃、-CHX⁵ ₂、-CH₂X⁵、-OCX⁵ ₃、-OCH₂X⁵、-OCHX⁵ ₂、-CN、-SR^5D、-NR^5AR^5B、-C(O)R^5C、-C(O)OR^5C、-C(O)NR^5AR^5B、-OR^5D、-NR^5AC(O)R^5C、-NR^5AC(O)OR^5CSubstituted or unsubstituted alkyl or substituted or unsubstituted heteroalkyl.

Each R^1A、R^1B、R^1C、R^1D、R^4A、R^4B、R^4C、R^4D、R^5A、R^5B、R^5CAnd R^5DIndependently hydrogen, halogen, -CF₃、-CBr₃、-CCl₃、-CI₃、-CHF₂、-CHBr₂、-CHCl₂、-CHI₂、-CH₂F、-CH₂Br、-CH₂Cl、-CH₂I、-OCF₃、-OCBr₃、-OCCl₃、-OCI₃、-OCHF₂、-OCHBr₂、-OCHCl₂、-OCHI₂、-OCH₂F、-OCH₂Br、-OCH₂Cl、-OCH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂、-NHC(O)NH₂、-NHSO₂H. -NHC (O) H, -NHC (O) OH, -NHOH, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. In the examples, each R^1A、R^1B、R^1C、R^1D、R^4A、R^4B、R^4C、R^4D、R^5A、R^5B、R^5CAnd R^5DIndependently hydrogen, halogen, -CF₃、-CBr₃、-CCl₃、-CI₃、-CHF₂、-CHBr₂、-CHCl₂、-CHI₂、-CH₂F、-CH₂Br、-CH₂Cl、-CH₂I、-OCF₃、-OCBr₃、-OCCl₃、-OCI₃、-OCHF₂、-OCHBr₂、-OCHCl₂、-OCHI₂、-OCH₂F、-OCH₂Br、-OCH₂Cl、-OCH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂、-NHC(O)NH₂、-NHSO₂H. -NHC (O) H, -NHC (O) OH, -NHOH, unsubstituted alkyl, unsubstituted heteroalkyl, unsubstituted cycloalkyl, unsubstituted heterocycloalkyl, unsubstituted aryl or unsubstituted heteroaryl. R bound to the same nitrogen atom^1AAnd R^1BThe substituents may optionally join to form a substituted or unsubstituted heterocycloalkyl or a substituted or unsubstituted heteroaryl. R bound to the same nitrogen atom^4AAnd R^4BThe substituents may optionally join to form a substituted or unsubstituted heterocycloalkyl or a substituted or unsubstituted heteroaryl. R bound to the same nitrogen atom^5AAnd R^5BThe substituents may optionally join to form a substituted or unsubstituted heterocycloalkyl or a substituted or unsubstituted heteroaryl. Each X¹、X⁴And X⁵Independently is-F, -Cl, -Br or-I.

In embodiments, the compound has the formula:

wherein ring B is heterocycloalkyl and R⁴、R⁵、L¹Ring A, R¹And z1 as described herein (including the examples). R⁶Independently of one another is halogen, -CX⁶ ₃、-CHX⁶ ₂、-CH₂X⁶、-OCX⁶ ₃、-OCH₂X⁶、-OCHX⁶ ₂、-CN、-SR^6D、-SO₂R^6D、-NR^6AR^6B、-C(O)R^6C、-C(O)OR^6C、-C(O)NR^6AR^6B、-OR^6D、-NR^6AC(O)R^6C-、-NR^6AC(O)NR^6C-、-NR^6AC(O)OR^6C、-SO₂NR^6AR^6B、-NR^6ASO₂R^6DSubstituted or unsubstituted alkyl, substituted or unsubstituted heteroalkylA substituted or unsubstituted heterocycloalkyl, a substituted or unsubstituted aryl, or a substituted or unsubstituted heteroaryl. The symbol z6 is an integer from 0 to 10.

Each R^6A、R^6B、R^6CAnd R^6DIndependently hydrogen, halogen, -CF₃、-CBr₃、-CCl₃、-CI₃、-CHF₂、-CHBr₂、-CHCl₂、-CHI₂、-CH₂F、-CH₂Br、-CH₂Cl、-CH₂I、-OCF₃、-OCBr₃、-OCCl₃、-OCI₃、-OCHF₂、-OCHBr₂、-OCHCl₂、-OCHI₂、-OCH₂F、-OCH₂Br、-OCH₂Cl、-OCH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂、-NHC(O)NH₂、-NHSO₂H. -NHC (O) H, -NHC (O) OH, -NHOH, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. R bound to the same nitrogen atom^6AAnd R^6BThe substituents may optionally join to form a substituted or unsubstituted heterocycloalkyl or a substituted or unsubstituted heteroaryl. Symbol X⁶Independently is-F, -Cl, -Br or-I.

In embodiments, the compound has the formula:

wherein R is²、R³、R⁴、R⁵、L¹、R¹And z1 as described herein (including the examples). Symbol W¹Is C (R)¹) CH or N.

In embodiments, the compound has the formula:wherein R is²、R³、R⁴、R⁵、L¹、R¹And z1 as described herein (including the examples).

In embodiments, the compound has the formula:wherein R is²、R³、R⁴、R⁵、L¹And R¹As described herein, including the examples.

In embodiments, the compound has the formula:

wherein ring B is heterocycloalkyl and R⁴、R⁵、L¹、R¹Ring a and z1 are as described herein, including the examples.

In embodiments, the compound has the formula:wherein R is⁶、z6、R⁴、R⁵、L¹、R¹Ring a and z1 are as described herein, including the examples.

In the examples, compoundsThe compound has the formula:

wherein R is⁶、z6、R⁴、R⁵、L¹、R¹Ring a and z1 are as described herein, including the examples.

In embodiments, the compound has the formula:

wherein R is⁶、z6、R⁴、R⁵、L¹、R¹Ring a and z1 are as described herein, including the examples.

In embodiments, the compound has the formula:

wherein R is⁶、z6、R⁴、R⁵、L¹、R¹、W¹And z1 as described herein (including the examples).

In embodiments, the compound has the formula:wherein R is⁶、z6、R⁴、R⁵、L¹、R¹Ring B and z1 are as described herein, including the examples.

In embodiments, the compound has the formula:

wherein R is⁶、z6、R⁴、R⁵、L¹、R¹Ring B and z1 are as described herein, including the examples.

In embodiments, the compound has the formula:wherein R is⁶、z6、R⁴、R⁵、L¹、R¹And ring B as described herein (including the examples).

In embodiments, the compound has the formula:

wherein R is⁶、z6、R⁴、R⁵、L¹、R¹And ring B as described herein (including the examples).

In embodiments, the compound has the formula:

wherein R is⁶、z6、R⁴、L¹、R¹And ring B as described herein (including the examples).

In embodiments, the compound has the formula:wherein R is⁶、z6、R⁴、L¹、R¹And ring B as described herein (including the examples).

In embodiments, the compound has the formula:

wherein R is^6A、R^6B、R^6C、R⁴、R⁵、L¹Ring A, z1, R¹And ring B as described herein (including the examples).

In embodiments, the compound has the formula:

wherein R is^6A、R^6B、R^6C、R⁴、R⁵、L¹Ring A, z1 and R¹As described herein, including the examples.

In embodiments, the compound has the formula:

wherein R is^6A、R^6B、R^6C、R⁴、R⁵、L¹Ring A, z1 and R¹As described herein, including the examples.

In embodiments, the compound has the formula:

wherein R is¹、z1、R^6A、R^6B、R^6C、R⁴And R⁵As described herein, including the examples. In embodiments, the compound has the formula:

wherein R is¹、z1、R^6A、R^6B、R^6C、R⁴And R⁵As described herein, including the examples.

In embodiments, the compound has the formula:

wherein R is^6A、R^6B、R^6C、R⁴And R⁵As described herein, including the examples. In embodiments, the compound has the formula:

wherein R is^6A、R^6B、R^6C、R⁴And R⁵As described herein, including the examples.

In embodiments, the compound has the formula:

wherein R is⁴、R⁵、L¹Ring A, R¹And z1 as described herein (including the examples); and z16 is an integer from 0 to 8. R³⁵Is oxo, halogen, -CCl₃、-CBr₃、-CF₃、-CI₃、CHCl₂、-CHBr₂、-CHF₂、-CHI₂、-CH₂Cl、-CH₂Br、-CH₂F、-CH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂、-NHC(O)NH₂、-NHSO₂H、-NHC(O)H、-NHC(O)OH、-NHOH、-OCCl₃、-OCF₃、-OCBr₃、-OCI₃、-OCHCl₂、-OCHBr₂、-OCHI₂、-OCHF₂、-OCH₂Cl、-OCH₂Br、-OCH₂I、-OCH₂F. Substituted or unsubstituted alkyl, substituted orUnsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.

In embodiments, the compound has the formula:

wherein R is³⁵、R⁴、R⁵、L¹Ring A, R¹And z1 as described herein (including the examples); and z16 is an integer from 1 to 8.

In embodiments, the compound has the formula:wherein R is³⁵、R⁴、R⁵、L¹Ring A, R¹And z1 as described herein (including the examples); and z16 is an integer from 1 to 8.

In embodiments, the compound has the formula:

wherein R is³⁵、R⁴、R⁵、L¹Ring A, R¹And z1 as described herein (including the examples); and z16 is an integer from 1 to 8.

In embodiments, the compound has the formula:wherein R is³⁵、R⁴、R⁵、L¹Ring A, R¹And z1 as described herein (including the examples); and z16 is an integer from 1 to 8.

In embodiments, the compound has the formula:

wherein R is³⁵、R⁴、R⁵、L¹Ring A, R¹And z1 as described herein (including the examples); and z16 is an integer from 1 to 8.

In embodiments, the compound has the formula:wherein R is³⁵、R⁴、R⁵、L¹Ring A, R¹And z1 as described herein (including the examples); and z16 is an integer from 1 to 8.

In embodiments, the compound has the formula:

wherein R is³⁵、R⁴、R⁵、L¹Ring A, R¹Z16 and z1 are as described herein, including the examples. In embodiments, the compound has the formula:

wherein R is³⁵、R⁴、R⁵、L¹Ring A, R¹Z16 and z1 are as described herein, including the examples.

In embodiments, the compound has the formula:

wherein R is³⁵、R⁴、R⁵、L¹Ring A, R¹Z16 and z1 are as described herein, including the examples. In embodiments, the compound has the formula:wherein R is³⁵、R⁴、R⁵、L¹Ring A, R¹Z16 and z1 are as described herein, including the examples.

In embodiments, the compound has the formula:

wherein R is⁶、z6、R⁴、R⁵And R¹As described herein, including the examples.

In embodiments, the compound has the formula:

wherein R is⁶、z6、R⁴And R⁵As described herein, including the examples.

In embodiments, the compound has the formula:

wherein R is⁶、z6、R⁴、R⁵And R¹As described herein, including the examples.

In embodiments, the compound has the formula:

wherein R is⁶、z6、R⁴And R⁵As described herein, including the examples.

In embodiments, the compound has the formula:

wherein R is⁶、R⁴、R⁵And R¹As described herein, including the examples.

In embodiments, the compound has the formula:

wherein R is⁶、R⁴、R⁵And R¹As described herein, including the examples.

In embodiments, the compound has the formula:

wherein R is¹、R⁴And R⁵As described herein.

In embodiments, the compound has the formula:

wherein R is¹、R⁴And R⁵As described herein.

In embodiments, the compound has the formula:

wherein R is¹、R⁴And R⁵As described herein.

In embodiments, the compound has the formula:

wherein R is⁶、z6、R¹、R⁴And R⁵As described herein.

In embodiments, the compound has the formula:

wherein R is⁴、R⁵Z6 and R⁶As described herein, including the examples.

In embodiments, the compound has the formula:

wherein R is⁶、R¹、R⁴And R⁵As described herein.

In embodiments, the compound has the formula:

wherein R is⁶、R⁴And R⁵As described herein.

In embodiments, the compound has the formula:

wherein R is¹、R⁴And R⁵As described herein, including the examples.

In embodiments, the compound has the formula:

wherein R is¹、R⁴And R⁵As described herein, including the examples.

In embodiments, the compound has the formula:

wherein R is¹、R⁴And R⁵As described herein (including the examples); and wherein R^6.1And R^6.2Each R at a fixed position on the bonded ring⁶。R^6.1And R^6.2Can independently be R as described herein (including any aspect, embodiment, example, drawing, or technical scheme)⁶Any substituent of (1). R^6.1And R^6.2May be hydrogen.

In embodiments, the compound has the formula:

wherein R is¹、z1、R²And R⁴As described herein, including the examples. In embodiments, the compound has the formula:

wherein R is¹、z1、R²And R⁴As described herein, including the examples. In embodiments, the compound has the formula:wherein R is¹、z1、R²And R⁴As described herein, including the examples.

In embodiments, the compound has the formula:

wherein R is¹Z1, ring A, L¹、R³、R⁴And R⁵As described herein, including the examples.

In embodiments, the compound has the formula:wherein R is¹、z1、W¹、L¹、R³、R⁴And R⁵As described herein, including the examples.

In embodiments, the compound has the formula:wherein R is¹、z1、L¹、R³、R⁴And R⁵As described herein, including the examples.

In embodiments, the compound has the formula:

wherein R is¹、z1、L¹、R³、R⁴And R⁵As described herein, including the examples.

In embodiments, the compound has the formula:

wherein R is¹、L¹、R³、R⁴And R⁵As described herein, including the examples.

In embodiments, the compound has the formula:wherein R is¹、L¹、R³、R⁴And R⁵As described herein, including the examples.

In embodiments, the compound has the formula:wherein L is¹、R³、R⁴And R⁵As described herein, including the examples.

In embodiments, the compound has the formula:wherein R is¹、z1、W¹、L¹And R³As described herein, including the examples.

In embodiments, the compound has the formula:

wherein R is¹Z1, ring A, L¹、R⁴And R⁵As described herein (including the examples); and wherein L²Is a bond, -S (O)₂-、-S(O)₂NH-、-NHS(O)₂-, -C (O) -, -C (O) NH-, -NHC (O) -, -NHC (O) O-, -NHC (O) NH-, -C (O) O-, -OC (O) -, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroarylene; ring C is cycloalkyl, heterocycloalkyl, aryl or heteroaryl; and z24 is an integer from 0 to 10. R²⁴Independently oxo, halogen, -CCl₃、-CBr₃、-CF₃、-CI₃、CHCl₂、-CHBr₂、-CHF₂、-CHI₂、-CH₂Cl、-CH₂Br、-CH₂F、-CH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂、-NHC(O)NH₂、-NHSO₂H、-NHC(O)H、-NHC(O)OH、-NHOH、-OCCl₃、-OCF₃、-OCBr₃、-OCI₃、-OCHCl₂、-OCHBr₂、-OCHI₂、-OCHF₂、-OCH₂Cl、-OCH₂Br、-OCH₂I、-OCH₂F、-N₃Quilt R²⁵Substituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl), by R²⁵Substituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl), with R²⁵Substituted or unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl), by R²⁵Substituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl), with R²⁵Substituted or unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl) or by R²⁵Substituted or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl). In an embodiment, z24 is 1. In an embodiment, z24 is 2. In an embodiment, z24 is 0.

In embodiments, the compound has the formula:wherein R is¹、z1、L¹、R⁴、R⁵、L²Ring C, R²⁴And z24 as described herein (including the examples).

In the examplesThe compound has the formula:

wherein R is¹、z1、L¹、R⁴、R⁵、L²Ring C, R²⁴And z24 as described herein (including the examples).

In embodiments, the compound has the formula:

wherein L is²、R⁴、R⁵、L¹Ring A, z1, R¹And ring B as described herein (including the examples). R³⁶Independently oxo, halogen, -CCl₃、-CBr₃、-CF₃、-CI₃、CHCl₂、-CHBr₂、-CHF₂、-CHI₂、-CH₂Cl、-CH₂Br、-CH₂F、-CH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂、-NHC(O)NH₂、-NHSO₂H、-NHC(O)H、-NHC(O)OH、-NHOH、-OCCl₃、-OCF₃、-OCBr₃、-OCI₃、-OCHCl₂、-OCHBr₂、-OCHI₂、-OCHF₂、-OCH₂Cl、-OCH₂Br、-OCH₂I、-OCH₂F、-N₃Quilt R³⁷Substituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl), by R³⁷Substituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl), with R³⁷Substituted or unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl), by R³⁷Substituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl,3-to 6-membered heterocycloalkyl or 5-to 6-membered heterocycloalkyl), with R³⁷Substituted or unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl) or by R³⁷Substituted or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl). The symbol z36 is an integer from 0 to 10. In an embodiment, z36 is 1. In an embodiment, z36 is 2. In the examples, when R³⁵Is a substituted or unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl), substituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl), substituted or unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl) or substituted or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl), R³⁵May be referred to herein as (Ring D) - (R)³⁶)_z36. In the examples, L²Is that

Wherein z16 is as described herein, including the examples. In the examples, L²Is that

In the examples, L²Is that

In embodiments, the compound has the formula:

wherein R is³⁵、R⁴、R⁵、L¹Ring A, R¹And z1 as described herein (including the examples).

In embodiments, the compound has the formula:

wherein R is³⁵、R⁴、R⁵、L¹Ring A, R¹And z1 as described herein (including the examples).

In embodiments, the compound has the formula:wherein R is³⁵、R⁴、R⁵、L¹Ring A, R¹And z1 as described herein (including the examples).

In embodiments, the compound has the formula:

wherein R is³⁵、R⁴、R⁵、L¹Ring A, R¹And z1 as described herein (including the examples).

In embodiments, the compound has the formula:wherein R is³⁵、R⁴、R⁵、L¹Ring A, R¹And z1 as described herein (including the examples).

In embodiments, the compound has the formula:

wherein R is³⁵、R⁴、R⁵、L¹Ring A, R¹And z1 as described herein (including the examples).

In embodiments, the compound has the formula:wherein R is³⁵、R⁴、R⁵、L¹Ring A, R¹And z1 as described herein (including the examples).

In embodiments, the compound has the formula:

wherein R is³⁵、R⁴、R⁵、L¹Ring A, R¹And z1 as described herein (including the examples).

In embodiments, the compound has the formula:

wherein R is³⁵、R⁴、R⁵、L¹Ring A, R¹Z16 and z1 are as described herein, including the examples. In embodiments, the compound has the formula:

wherein R is³⁵、R⁴、R⁵、L¹Ring A, R¹Z16 and z1 are as defined in (A), (B), (CIncluding the examples). In embodiments, the compound has the formula:

wherein R is³⁵、R⁴、R⁵、L¹Ring A, R¹Z16 and z1 are as described herein, including the examples. In embodiments, the compound has the formula:

wherein R is³⁵、R⁴、R⁵、L¹Ring A, R¹Z16 and z1 are as described herein, including the examples.

In embodiments, the compound has the formula:

wherein R is³⁵、R⁴、R⁵、L¹Ring A, R¹Z16 and z1 are as described herein, including the examples.

In embodiments, the compound has the formula:wherein R is³⁵、R⁴、R⁵、L¹Ring A, R¹Z16 and z1 are as described herein, including the examples.

In the examples, the compounds areWherein R is³⁵、R¹And z1 as described hereinThe above-mentioned processes are described.

In the examples, the compounds are

Wherein R is³⁵、R¹And z1 are as described herein.

In the examples, the compounds areWherein R is³⁵、R¹And z1 are as described herein.

In the examples, the compounds areWherein R is³⁵And R¹As described herein.

In the examples, the compounds areWherein R is³⁵And X¹As described herein.

In the examples, the compounds are

Wherein R is³⁵As described herein.

In the examples, the compounds areWherein R is³⁵As described herein.

In the examples, the compounds areWherein R is¹And R³⁵As described herein.

In the examples, the compounds are

Wherein R is¹And R³⁵As described herein.

In the examples, the compounds areWherein R is¹And R³⁵As described herein.

In the examples, the compounds are

Wherein X¹And R³⁵As described herein.

In the examples, the compounds areWherein R is³⁵As described herein.

In the examples, the compounds are

Wherein R is³⁵As described herein.

In the examples, the compounds areWherein R is¹Z1 and R³⁵As described herein.

In the examples, the compounds areWherein R is¹And R³⁵As described herein.

In the examples, the compounds areWherein z1, R¹And R³⁵As described herein.

In the examples, the compounds areWherein R is¹Z1 and R³⁵As described herein.

In the examples, the compounds are

Wherein z1, R¹And R³⁵As described herein.

In the examples, the compounds are

Wherein R is¹And R³⁵As described herein.

In the examples, the compounds areWherein R is¹And R³⁵As described herein.

In the examples, the compounds are

Wherein R is¹And R³⁵As described herein.

In the examples, L²Is a substituted or unsubstituted alkylene (e.g., C)₁-C₈Alkylene, or a mixture thereof,C₁-C₆Alkylene or C₁-C₄Alkylene). In the examples, L²Is a substituted alkylene group (e.g. C)₁-C₈Alkylene radical, C₁-C₆Alkylene or C₁-C₄Alkylene). In the examples, L²Is unsubstituted alkylene (e.g. C)₁-C₈Alkylene radical, C₁-C₆Alkylene or C₁-C₄Alkylene). In the examples, L²Is a substituted or unsubstituted heteroalkylene group (e.g., 2-to 8-membered heteroalkylene, 2-to 6-membered heteroalkylene, or 2-to 4-membered heteroalkylene). In the examples, L²Is a substituted heteroalkylene group (e.g., a 2-to 8-membered heteroalkylene group, a 2-to 6-membered heteroalkylene group, or a 2-to 4-membered heteroalkylene group). In the examples, L²Is unsubstituted heteroalkylene (e.g., 2-to 8-membered heteroalkylene, 2-to 6-membered heteroalkylene, or 2-to 4-membered heteroalkylene). In the examples, L²Is substituted or unsubstituted C₁-C₆An alkylene group. In the examples, L²Is substituted or unsubstituted C₁-C₄An alkylene group. In the examples, L²Is substituted or unsubstituted C₁-C₃An alkylene group. In the examples, L²Is substituted or unsubstituted C₁-C₂An alkylene group.

In the examples, L²Is that

Wherein z16 is as described herein, including the examples.

In the examples, L²Is that

In the examples, L²Is thatIn the examples, L²Is that

In the examples, L²Is that

In the examples, L²Is thatIn the examples, L²Is thatIn the examples, L²Is that

In the examples, L²Is thatIn the examples, L²Is that

In the examples, L²Is that

In the examples, L²Is thatIn the examples, L²Is thatIn the examples, L²Is thatIn the examples, L²Is thatIn the examples, L²Is that

In the examples, L²Is that

In the examples, L²Is thatIn the examples, L²Is that

In the implementation ofIn the examples, R¹Is substituted or unsubstituted C₁-C₆Alkyl or substituted or unsubstituted 2 to 6 membered heteroalkyl.

In the examples, R¹Independently oxo, halogen, -CCl₃、-CBr₃、-CF₃、-CI₃、CHCl₂、-CHBr₂、-CHF₂、-CHI₂、-CH₂Cl、-CH₂Br、-CH₂F、-CH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂、-NHC(O)NH₂、-NHSO₂H、-NHC(O)H、-NHC(O)OH、-NHOH、-OCCl₃、-OCF₃、-OCBr₃、-OCI₃、-OCHCl₂、-OCHBr₂、-OCHI₂、-OCHF₂、-OCH₂Cl、-OCH₂Br、-OCH₂I、-OCH₂F、-N₃Quilt R²⁰Substituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl) or by R²⁰Substituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl).

In the examples, R^1A、R^1B、R^1CAnd R^1DIndependently hydrogen, halogen, -CF₃、-CBr₃、-CCl₃、-CI₃、-CHF₂、-CHBr₂、-CHCl₂、-CHI₂、-CH₂F、-CH₂Br、-CH₂Cl、-CH₂I、-OCF₃、-OCBr₃、-OCCl₃、-OCI₃、-OCHF₂、-OCHBr₂、-OCHCl₂、-OCHI₂、-OCH₂F、-OCH₂Br、-OCH₂Cl、-OCH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂Quilt R²⁰Substituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl) or by R²⁰Substituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl).

In the examples, R^1A、R^1B、R^1C、R^1DIndependently is by R²⁰Substituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^1A、R^1B、R^1CAnd R^1DIndependently is by R²⁰Substituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^1A、R^1B、R^1CAnd R^1DIndependently is unsubstitutedAlkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^1A,R^1B,R^1C,R^1Dare independentlyR²⁰-a substitated or unsubstitated heteroalkyi (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R^1A、R^1B、R^1CAnd R^1DIndependently is by R²⁰Substituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R^1A、R^1B、R^1CAnd R^1DIndependently an unsubstituted heteroalkyl group (e.g., a 2-to 8-membered heteroalkyl group, a 2-to 6-membered heteroalkyl group, or a 2-to 4-membered heteroalkyl group).

In the examples, R^1A、R^1B、R^1CAnd R^1DIndependently is by R²⁰Substituted or unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl), by R²⁰Substituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl), with R²⁰Substituted or unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl) or by R²⁰Substituted or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl).

R²⁰Independently oxo, halogen, -CCl₃、-CBr₃、-CF₃、-CI₃、CHCl₂、-CHBr₂、-CHF₂、-CHI₂、-CH₂Cl、-CH₂Br、-CH₂F、-CH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂、-NHC(O)NH₂、-NHSO₂H、-NHC(O)H、-NHC(O)OH、-NHOH、-OCCl₃、-OCF₃、-OCBr₃、-OCI₃、-OCHCl₂、-OCHBr₂、-OCHI₂、-OCHF₂、-OCH₂Cl、-OCH₂Br、-OCH₂I、-OCH₂F、-N₃Quilt R²¹Substituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl), by R²¹Substituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl), with R²¹Substituted or unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl), by R²¹Substituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl), with R²¹Substituted or unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl) or by R²¹Substituted or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl).

R²¹Independently oxo, halogen, -CCl₃、-CBr₃、-CF₃、-CI₃、CHCl₂、-CHBr₂、-CHF₂、-CHI₂、-CH₂Cl、-CH₂Br、-CH₂F、-CH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂、-NHC(O)NH₂、-NHSO₂H、-NHC(O)H、-NHC(O)OH、-NHOH、-OCCl₃、-OCF₃、-OCBr₃、-OCI₃、-OCHCl₂、-OCHBr₂、-OCHI₂、-OCHF₂、-OCH₂Cl、-OCH₂Br、-OCH₂I、-OCH₂F、-N₃Quilt R²²Substituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical、C₁-C₆Alkyl or C₁-C₄Alkyl), by R²²Substituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl), with R²²Substituted or unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl), by R²²Substituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl), with R²²Substituted or unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl) or by R²²Substituted or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl).

In the examples, R¹Is by R²⁰Substituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R¹Is by R²⁰Substituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R¹Is unsubstituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R¹Is by R²⁰Substituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R¹Is by R²⁰Substituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R¹Is unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R¹Is by R²⁰Substituted or unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups). In the examples, R¹Is by R²⁰SubstitutionCycloalkyl (e.g. C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups). In the examples, R¹Is unsubstituted cycloalkyl (e.g. C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups). In the examples, R¹Is by R²⁰Substituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl). In the examples, R¹Is by R²⁰Substituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl). In the examples, R¹Is unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl). In the examples, R¹Is by R²⁰Substituted or unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl). In the examples, R¹Is by R²⁰Substituted aryl radicals (e.g. C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl). In the examples, R¹Is unsubstituted aryl (e.g. C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl). In the examples, R¹Is by R²⁰Substituted or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl). In the examples, R¹Is by R²⁰Substituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl). In the examples, R¹Is unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl). In the examples, R¹is-SO₂R^1D、-SO₂NR^1AR^1Bor-NR^1ASO₂R^1D. In the examples, R¹is-SO₂R^1D. In the examples, R¹is-SO₂NR^1AR^1B. In the examples, R¹is-NR^1ASO₂R^1D。

In the examples, R¹Independently is-OH. In the examples, R¹Independently is-OCH₃. In the examples, R¹Independently is-OCH₂CH₃. In the examples, R¹Independently is unsubstituted C₁-C₄An alkoxy group. In the examples, R¹Independently is-Cl. In the examples, R¹Independently is-F. In the examples, R¹Independently a halogen. In the examples, R¹Independently is-CH₃. In the examples, R¹Independently is-CH₂CH₃. In the examples, R¹Independently is unsubstituted C₁-C₄An alkyl group. In the examples, R¹Independently is-CF₃. In the examples, R¹Independently is-CX¹ ₃. In the examples, R¹Independently is-OCH₃or-F. In the examples, R¹Independently is unsubstituted C₁-C₄Alkoxy or halogen. In the examples, R¹Independently is-CN. In the examples, R¹Independently is-C (O) NH₂. In the examples, R¹Independently is-C (O) NR^1AR^1B. In the examples, R^1AIndependently hydrogen. In the examples, R^1AIndependently is unsubstituted C₁-C₄An alkyl group. In the examples, R^1AIndependently is-CH₃. In the examples, R^1AIndependently is-CH₂CH₃. In the examples, R^1BIndependently hydrogen. In the examples, R^1BIndependently is unsubstituted C₁-C₄An alkyl group. In the examples, R^1BIndependently is-CH₃. In the examples, R^1BIndependently is-CH₂CH₃. In the examples, R^1CIndependently hydrogen. In the examples, R^1CIndependently is unsubstituted C₁-C₄An alkyl group. In the examples, R^1CIndependently is-CH₃. In the examples, R^1CIndependently is-CH₂CH₃. In the examples, R^1DIndependently hydrogen. In the examples, R^1DIndependently is unsubstituted C₁-C₄An alkyl group. In the examples, R^1DIndependently is-CH₃. In the examples, R^1DIndependently is-CH₂CH₃。

In the examples, R²Is hydrogen, substituted or unsubstituted C₁-C₆Alkyl, substituted or unsubstituted 2-to 6-membered heteroalkyl, substituted or unsubstituted C₃-C₆Cycloalkyl, substituted or unsubstituted 3-to 6-membered heterocycloalkyl, substituted or unsubstituted phenyl, or substituted or unsubstituted 5-to 6-membered heteroaryl.

In the examples, R²Independently is hydrogen, is R²³Substituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl), by R²³Substituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl), with R²³Substituted or unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl), by R²³Substituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl), with R²³Substituted or unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl) or by R²³Substituted or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl). In the examples, R²Independently hydrogen.

In the examples, R²Is by R²³Substituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R²Is by R²³Substituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R²Is unsubstituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R²Is by R²³Substituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R²Is by R²³Substituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R²Is unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R²Is by R²³Substituted or unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups). In the examples, R²Is by R²³Substituted cycloalkyl (e.g. C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups). In the examples, R²Is unsubstituted cycloalkyl (e.g. C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups). In the examples, R²Is by R²³Substituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl). In the examples, R²Is by R²³Substituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl). In the examples, R²Is unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl). In the examples, R²Is by R²³Substituted or unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl). In the examples, R²Is by R²³Substituted aryl radicals (e.g. C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl). In the examples, R²Is unsubstitutedAryl (e.g. C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl). In the examples, R²Is by R²³Substituted or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl). In the examples, R²Is by R²³Substituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl). In the examples, R²Is unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl). In the examples, when R²When divalent, it may be referred to herein as L²。

R²³Independently oxo, halogen, -CCl₃、-CBr₃、-CF₃、-CI₃、CHCl₂、-CHBr₂、-CHF₂、-CHI₂、-CH₂Cl、-CH₂Br、-CH₂F、-CH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂、-NHC(O)NH₂、-NHSO₂H、-NHC(O)H、-NHC(O)OH、-NHOH、-OCCl₃、-OCF₃、-OCBr₃、-OCI₃、-OCHCl₂、-OCHBr₂、-OCHI₂、-OCHF₂、-OCH₂Cl、-OCH₂Br、-OCH₂I、-OCH₂F、-N₃Quilt R²⁴Substituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl), by R²⁴Substituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl), with R²⁴Substituted or unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl), by R²⁴Substituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkylHeterocyclic alkyl radical) by R²⁴Substituted or unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl) or by R²⁴Substituted or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl). In the examples, when R²³Is by R²⁴Substituted or unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl), by R²⁴Substituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl), with R²⁴Substituted or unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl) or by R²⁴When substituted or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl), it may be referred to herein as being (R)²⁴)_z4Substituted ring C.

In the examples, R²³Independently an oxo group. In the examples, R²³Independently a halogen. In the examples, R²³Independently is-CCl₃. In the examples, R²³Independently is-CBr₃. In the examples, R²³Independently is-CF₃. In the examples, R²³Independently is-CI₃. In the examples, R²³Independently is CHCl₂. In the examples, R²³Independently is-CHBr₂. In the examples, R²³Independently is-CHF₂. In the examples, R²³Independently is-CHI₂. In the examples, R²³Independently is-CH₂And (4) Cl. In the examples, R²³Independently is-CH₂Br is added. In the examples, R²³Independently is-CH₂F. In the examples, R²³Independently is-CH₂I. In the examples, R²³Independently is-CN. In the examples, R²³Independently is-OH. In the examples, R²³Independently is-NH₂. In the examples, R²³Independent of each otherAnd ground is-COOH. In the examples, R²³Independently is-CONH₂. In the examples, R²³Independently is-NO₂. In the examples, R²³Independently is-SH. In the examples, R²³Independently is-SO₃H. In the examples, R²³Independently is-SO₄H. In the examples, R²³Independently is-SO₂NH₂. In the examples, R²³Independently is-NHNH₂. In the examples, R²³Independently is-ONH₂. In the examples, R²³Independently is-NHC (O) NHNH₂. In the examples, R²³Independently is-NHC (O) NH₂. In the examples, R²³Independently is-NHSO₂H. In the examples, R²³independently-NHC (O) H. In the examples, R²³independently-NHC (O) OH. In the examples, R²³independently-NHOH. In the examples, R²³Independently is-OCCl₃. In the examples, R²³Independently is-OCF₃. In the examples, R²³Independently is-OCBr₃. In the examples, R²³Independently is-OCI₃. In the examples, R²³Independently is-OCHCl₂. In the examples, R²³Independently is-OCHBr₂. In the examples, R²³Independently is-OCHI₂. In the examples, R²³Independently is-OCHF₂. In the examples, R²³Independently is-OCH₂And (4) Cl. In the examples, R²³Independently is-OCH₂Br is added. In the examples, R²³Independently is-OCH₂I. In the examples, R²³Independently is-OCH₂F. In the examples, R²³Independently is-N₃。

In the examples, R²³Is by R²⁴Substituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R²³Is by R²⁴Substituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R²³Is unsubstituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups).

In the examples, R²³Is by R²⁴Substituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R²³Is by R²⁴Substituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R²³Is unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl).

In the examples, R²³Is by R²⁴Substituted or unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups). In the examples, R²³Is by R²⁴Substituted cycloalkyl (e.g. C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups). In the examples, R²³Is unsubstituted cycloalkyl (e.g. C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups).

In the examples, R²³Is by R²⁴Substituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl). In the examples, R²³Is by R²⁴Substituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl). In the examples, R²³Is unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl).

In the examples, R²³Is by R²⁴Substituted or unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl radicalsOr phenyl). In the examples, R²³Is by R²⁴Substituted aryl radicals (e.g. C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl). In the examples, R²³Is unsubstituted aryl (e.g. C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl).

In the examples, R²³Is by R²⁴Substituted or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl). In the examples, R²³Is by R²⁴Substituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl). In the examples, R²³Is unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl).

In the examples, R²³Is by R²⁴Substituted or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl). In the examples, R²³Is a substituted or unsubstituted pyridyl group. In the examples, R²³Is by R²⁴A substituted pyridyl group. In the examples, R²³Is an unsubstituted pyridyl group. In the examples, R²³Is a substituted or unsubstituted pyrimidinyl group. In the examples, R²³Is by R²⁴A substituted pyrimidinyl group. In the examples, R²³Is an unsubstituted pyrimidinyl group. In the examples, R²³Is methoxy. In the examples, R²³Is a substituted or unsubstituted phenyl group. In the examples, R²³Is by R²⁴A substituted phenyl group. In the examples, R²³Is unsubstituted phenyl. In the examples, R²³Is a substituted or unsubstituted pyridazinyl group. In the examples, R²³Is by R²⁴A substituted pyridazinyl group. In the examples, R²⁴Is an unsubstituted pyridazinyl group.

In the examples, R²⁴Independently is-OH. In the examples, R²⁴Independently is-OCH₃. In the examples, R²⁴Independently is-OCH₂CH₃. In the examples, R²⁴Independently is-F. In the examples, R²⁴Independently is-NHC (O) CH₃. In the examples, R²⁴independently-COOH. In the examples, R²⁴Independently is-SO₂NH₂。

In the examples, R²⁴Is by R²⁵Substituted or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl). In the examples, R²⁴Is a substituted or unsubstituted pyridyl group. In the examples, R²⁴Is by R²⁵A substituted pyridyl group. In the examples, R²⁴Is an unsubstituted pyridyl group. In the examples, R²⁴Is a substituted or unsubstituted pyrimidinyl group. In the examples, R²⁴Is by R²⁵A substituted pyrimidinyl group. In the examples, R²⁴Is an unsubstituted pyrimidinyl group. In the examples, R²⁴Is methoxy. In the examples, R²⁴Is a substituted or unsubstituted phenyl group. In the examples, R²⁴Is by R²⁵A substituted phenyl group. In the examples, R²⁴Is unsubstituted phenyl. In the examples, R²⁴Is a substituted or unsubstituted pyridazinyl group. In the examples, R²⁴Is by R²⁵A substituted pyridazinyl group. In the examples, R²⁴Is an unsubstituted pyridazinyl group.

In the examples, R²Is by R²³Substituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R²Is by R²³Substituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R²Is unsubstituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R²Is by R²³Substituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl)Alkyl or 2 to 4 membered heteroalkyl). In the examples, R²Is by R²³Substituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R²Is unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R²Is by R²³Substituted or unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups). In the examples, R²Is by R²³Substituted cycloalkyl (e.g. C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups). In the examples, R²Is unsubstituted cycloalkyl (e.g. C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups). In the examples, R²Is by R²³Substituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl). In the examples, R²Is by R²³Substituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl). In the examples, R²Is unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl). In the examples, R²Is by R²³Substituted or unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl). In the examples, R²Is by R²³Substituted aryl radicals (e.g. C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl). In the examples, R²Is unsubstituted aryl (e.g. C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl). In the examples, R²Is by R²³Substituted or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl). In the examples, R²Is by R²³Substituted heteroaryl (e.g., 5 to 10 membered)Heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl). In the examples, R²Is unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl). In the examples, R²Is substituted or unsubstituted C₁-C₆An alkyl group. In the examples, R²Is substituted or unsubstituted C₃-C₆A cycloalkyl group. In the examples, R²Is hydrogen.

In the examples, R²Is ethyl substituted with substituted or unsubstituted pyridyl. In the examples, R²Is ethyl substituted with a substituted or unsubstituted 5-to 6-membered heteroaryl. In the examples, R²Is ethyl substituted with substituted or unsubstituted heteroaryl. In the examples, R²Is C substituted with a substituted or unsubstituted 5-to 6-membered heteroaryl group₁-C₄An alkyl group. In the examples, R²Is C substituted by substituted or unsubstituted heteroaryl₁-C₄An alkyl group. In the examples, R²Is ethyl substituted with a substituted pyridyl group. In the examples, R²Is ethyl substituted with a substituted 5-to 6-membered heteroaryl. In the examples, R²Is ethyl substituted with a substituted heteroaryl group. In the examples, R²Is substituted with a substituted 5-to 6-membered heteroaryl group₁-C₄An alkyl group. In the examples, R²Is substituted with substituted heteroaryl₁-C₄An alkyl group. In the examples, R²Is substituted C₁-C₄An alkyl group. In the examples, R²Is a substituted ethyl group. In the examples, R²Is an ethyl group substituted with an unsubstituted pyridyl group. In the examples, R²Is an unsubstituted 5-to 6-membered heteroaryl substituted ethyl group. In the examples, R²Is an unsubstituted heteroaryl substituted ethyl. In the examples, R²Is unsubstituted 5-to 6-membered heteroaryl substituted C₁-C₄An alkyl group. In the examples, R²Is unsubstituted heteroaryl substituted C₁-C₄An alkyl group.

In the examples, R²Is methyl substituted by substituted or unsubstituted pyrimidinyl. In the examples, R²Is methyl substituted with a substituted or unsubstituted 5-to 6-membered heteroaryl. In the examples, R²Is methyl substituted with substituted or unsubstituted heteroaryl. In the examples, R²Is a substituted methyl group. In the examples, R²Is methyl substituted with a substituted pyrimidinyl group. In the examples, R²Is methyl substituted with a substituted 5-to 6-membered heteroaryl group. In the examples, R²Is methyl substituted with a substituted heteroaryl group. In the examples, R²Is unsubstituted methyl. In the examples, R²Is substituted C₁-C₄An alkyl group. In the examples, R²Is an unsubstituted pyrimidinyl-substituted methyl group. In the examples, R²Is an unsubstituted 5-to 6-membered heteroaryl substituted methyl. In the examples, R²Is methyl substituted with unsubstituted heteroaryl.

In the examples, R²Is methyl substituted by substituted or unsubstituted pyridyl. In the examples, R²Is methyl substituted by methoxy substituted pyridyl. In the examples, R²Is methyl substituted with a substituted pyridyl group. In the examples, R²Is methyl substituted with a substituted pyridyl group. In the examples, R²Is methyl substituted by unsubstituted pyridyl.

In the examples, R²Is C substituted by methoxy-substituted pyridyl₁-C₄An alkyl group. In the examples, R²Is substituted by a substituted pyridyl group₁-C₄An alkyl group. In the examples, R²Is substituted with a substituted 5-to 6-membered heteroaryl group₁-C₄An alkyl group. In the examples, R²Is substituted with substituted heteroaryl₁-C₄An alkyl group. In the examples, R²Is unsubstituted 5-to 6-membered heteroaryl substituted C₁-C₄An alkyl group. In the examples, R²Is unsubstituted heteroaryl substituted C₁-C₄An alkyl group.

In the examplesWherein R2 is unsubstituted methyl. In the examples, R²Is unsubstituted C₁-C₄An alkyl group. In the examples, R²Is cyclopentyl substituted by methyl. In the examples, R²Is a quilt C₁-C₄Alkyl-substituted cyclopentyl. In the examples, R²Is C substituted by methyl₃-C₆A cycloalkyl group. In the examples, R²Is substituted C₃-C₆A cycloalkyl group. In the examples, R²Is a substituted cyclopentyl group.

In the examples, R²Is propyl substituted with substituted or unsubstituted pyridyl. In the examples, R²Is a substituted or unsubstituted 5-to 6-membered heteroaryl substituted propyl. In the examples, R²Is propyl substituted with substituted or unsubstituted heteroaryl. In the examples, R²Is a substituted propyl group. In the examples, R²Is C substituted by substituted or unsubstituted pyridyl₁-C₆An alkyl group. In the examples, R²Is C substituted with a substituted or unsubstituted 5-to 6-membered heteroaryl group₁-C₆An alkyl group. In the examples, R²Is C substituted by substituted or unsubstituted heteroaryl₁-C₆An alkyl group. In the examples, R²Is propyl substituted with a substituted pyridyl group. In the examples, R²Is a substituted 5-to 6-membered heteroaryl substituted propyl. In the examples, R²Is a substituted heteroaryl substituted propyl. In the examples, R²Is unsubstituted propyl. In the examples, R²Is substituted by a substituted pyridyl group₁-C₆An alkyl group. In the examples, R²Is substituted with a substituted 5-to 6-membered heteroaryl group₁-C₆An alkyl group. In the examples, R²Is substituted with substituted heteroaryl₁-C₆An alkyl group. In the examples, R²Is substituted C₁-C₆An alkyl group. In the examples, R²Is propyl substituted with unsubstituted pyridyl. In the examples, R²Is unsubstituted 5-to 6-membered heteroaryl substitutedPropyl group of (2). In the examples, R²Is an unsubstituted heteroaryl substituted propyl. In the examples, R²Is a substituted propyl group. In the examples, R²Is unsubstituted pyridyl substituted C₁-C₆An alkyl group. In the examples, R²Is unsubstituted 5-to 6-membered heteroaryl substituted C₁-C₆An alkyl group. In the examples, R²Is unsubstituted heteroaryl substituted C₁-C₆An alkyl group.

In the examples, R²Is methyl substituted with substituted or unsubstituted phenyl. In the examples, R²Is methyl substituted with substituted or unsubstituted aryl. In the examples, R²Is a substituted methyl group. In the examples, R²Is C substituted by substituted or unsubstituted phenyl₁-C₄An alkyl group. In the examples, R²Is C substituted by substituted or unsubstituted aryl₁-C₄An alkyl group. In the examples, R²Is substituted C₁-C₄An alkyl group. In the examples, R²Is methyl substituted by unsubstituted phenyl. In the examples, R²Is an unsubstituted aryl-substituted methyl group. In the examples, R²Is unsubstituted phenyl-substituted C₁-C₄An alkyl group. In the examples, R²Is unsubstituted aryl-substituted C₁-C₄An alkyl group. In the examples, R²Is methyl substituted with a substituted phenyl group. In the examples, R²Is methyl substituted with substituted aryl. In the examples, R²Is substituted by substituted phenyl₁-C₄An alkyl group. In the examples, R²Is substituted by substituted aryl₁-C₄An alkyl group.

In the examples, R²Is methyl substituted with a substituted or unsubstituted pyridazinyl group. In the examples, R²Is a substituted or unsubstituted pyridazinyl group₁-C₄An alkyl group. In the examples, R²Is a substituted pyridazinyl substituted methyl group. In the examples, R²Is substituted by a substituted pyridazinyl group C₁-C₄An alkyl group. In the examples, R²Is a methyl group substituted with an unsubstituted pyridazinyl group. In the examples, R²Is unsubstituted pyridazinyl substituted C₁-C₄An alkyl group.

In the examples, R²Is an unsubstituted ethyl group. In the examples, R²Is unsubstituted C₁-C₄An alkyl group.

In the examples, R²Is a pyridyl group substituted with a methoxy group. In the examples, R²Is a substituted pyridyl group. In the examples, R²Is a 5 to 6 membered heteroaryl substituted with methoxy. In the examples, R²Is a substituted 5-to 6-membered heteroaryl. In the examples, R²Is a substituted heteroaryl group.

In the examples, R²Is a methyl group substituted with a piperidinyl group substituted with a substituted or unsubstituted benzyl group. In the examples, R²Is a substituted benzyl-substituted piperidinyl-substituted methyl group. In the examples, R²Is an unsubstituted benzyl-substituted piperidinyl-substituted methyl group. In the examples, R²Is methyl substituted with a substituted piperidinyl group. In the examples, R²Is methyl substituted with a substituted or unsubstituted 5-to 6-membered heterocycloalkyl group. In the examples, R²Is a substituted 5-to 6-membered heterocycloalkyl substituted methyl group. In the examples, R²Is methyl substituted by substituted or unsubstituted heterocycloalkyl. In the examples, R²Is a substituted heterocycloalkyl substituted methyl group. In the examples, R²Is a substituted methyl group. In the examples, R²Is C substituted by a substituted or unsubstituted benzyl-substituted piperidinyl group₁-C₄An alkyl group. In the examples, R²Is a substituted benzyl-substituted piperidinyl-substituted C₁-C₄An alkyl group. In the examples, R²Is substituted with a substituted piperidinyl group₁-C₄An alkyl group. In the examples, R²Is C substituted by substituted or unsubstituted 5-to 6-membered heterocycloalkyl₁-C₄An alkyl group. In the examples, R²Is C substituted by substituted or unsubstituted heterocycloalkyl₁-C₄An alkyl group. In the examples, R²Is substituted C₁-C₄An alkyl group. In the examples, R²Is an unsubstituted benzyl-substituted piperidinyl-substituted methyl group. In the examples, R²Is methyl substituted with a substituted piperidinyl group. In the examples, R²Is a substituted 5-to 6-membered heterocycloalkyl substituted methyl group. In the examples, R²Is a substituted heterocycloalkyl substituted methyl group. In the examples, R²Is unsubstituted benzyl-substituted piperidinyl-substituted C₁-C₄An alkyl group. In the examples, R²Is substituted with a substituted piperidinyl group₁-C₄An alkyl group. In the examples, R²Is substituted with a substituted 5-to 6-membered heterocycloalkyl group₁-C₄An alkyl group. In the examples, R²Is substituted by a substituted heterocycloalkyl group₁-C₄An alkyl group.

In the examples, R²Is a 4-membered heteroalkyl group substituted with a substituted or unsubstituted pyridyl group. In the examples, R²Is a 4-membered heteroalkyl group substituted with a substituted or unsubstituted 5-to 6-membered heteroaryl group. In the examples, R²Is a 4-membered heteroalkyl group substituted with a substituted or unsubstituted heteroaryl group. In the examples, R²Is a2 to 6 membered heteroalkyl group substituted with a substituted or unsubstituted pyridyl group. In the examples, R²Is a 2-to 6-membered heteroalkyl substituted with a substituted or unsubstituted 5-to 6-membered heteroaryl. In the examples, R²Is a2 to 6 membered heteroalkyl group substituted with a substituted or unsubstituted heteroaryl group. In the examples, R²Is a 4-membered heteroalkyl group substituted with a substituted pyridyl group. In the examples, R²Is a substituted 5-to 6-membered heteroaryl substituted 4-membered heteroalkyl. In the examples, R²Is a substituted heteroaryl substituted 4-membered heteroalkyl. In the examples, R²Is a2 to 6 membered heteroalkyl substituted with a substituted pyridyl. In the examples, R²Is a 2-to 6-membered heteroalkyl substituted with a substituted 5-to 6-membered heteroaryl. In thatIn the examples, R²Is a2 to 6 membered heteroalkyl substituted with a substituted heteroaryl.

In the examples, R²Is a 4-membered heteroalkyl group substituted with an unsubstituted pyridyl group. In the examples, R²Is an unsubstituted 5-to 6-membered heteroaryl substituted 4-membered heteroalkyl. In the examples, R²Is an unsubstituted heteroaryl substituted 4 membered heteroalkyl. In the examples, R²Is a2 to 6 membered heteroalkyl substituted with an unsubstituted pyridyl. In the examples, R²Is an unsubstituted 5-to 6-membered heteroaryl substituted 2-to 6-membered heteroalkyl. In the examples, R²Is an unsubstituted heteroaryl substituted 2 to 6 membered heteroalkyl group.

In the examples, R²Is ethyl substituted with a substituted or unsubstituted imidazolyl. In the examples, R²Is ethyl substituted with a substituted or unsubstituted 5-to 6-membered heteroaryl. In the examples, R²Is ethyl substituted with substituted or unsubstituted heteroaryl. In the examples, R²Is C substituted by a substituted or unsubstituted imidazolyl group₁-C₄An alkyl group. In the examples, R²Is C substituted with a substituted or unsubstituted 5-to 6-membered heteroaryl group₁-C₄An alkyl group. In the examples, R²Is C substituted by substituted or unsubstituted heteroaryl₁-C₄An alkyl group. In the examples, R²Is ethyl substituted with a substituted imidazolyl group. In the examples, R²Is ethyl substituted with a substituted 5-to 6-membered heteroaryl. In the examples, R²Is ethyl substituted with a substituted heteroaryl group. In the examples, R²Is substituted by a substituted imidazolyl group₁-C₄An alkyl group. In the examples, R²Is substituted with a substituted 5-to 6-membered heteroaryl group₁-C₄An alkyl group. In the examples, R²Is substituted with substituted heteroaryl₁-C₄An alkyl group.

In the examples, R²Is an ethyl group substituted with an unsubstituted imidazolyl group. In the examples, R²Is an unsubstituted 5-to 6-membered heteroaryl substituted ethyl group. In the examples，R²Is an unsubstituted heteroaryl substituted ethyl. In the examples, R²Is unsubstituted imidazolyl-substituted C₁-C₄An alkyl group. In the examples, R²Is unsubstituted 5-to 6-membered heteroaryl substituted C₁-C₄An alkyl group. In the examples, R²Is unsubstituted heteroaryl substituted C₁-C₄An alkyl group.

In the examples, R²Is ethyl substituted by OH. In the examples, R²Is C substituted by OH₁-C₄An alkyl group. In the examples, R²Is a substituted ethyl group. In the examples, R²Is substituted C₁-C₄An alkyl group.

In the examples, R²Is unsubstituted 4-membered heteroalkyl-substituted piperidinyl-substituted methyl. In the examples, R²Is an unsubstituted heteroalkyl-substituted piperidinyl-substituted methyl group. In the examples, R²Is a substituted 5-to 6-membered heterocycloalkyl substituted methyl group. In the examples, R²Is unsubstituted 4-membered heteroalkyl-substituted piperidinyl-substituted C₁-C₄An alkyl group. In the examples, R²Is unsubstituted heteroalkyl-substituted piperidinyl-substituted C₁-C₄An alkyl group. In the examples, R²Is substituted with a substituted 5-to 6-membered heterocycloalkyl group₁-C₄An alkyl group. In the examples, R²Is substituted by a substituted heterocycloalkyl group₁-C₄An alkyl group.

In the examples, R²Is pyrrolidinyl substituted with tert-butoxycarbonyl. In the examples, R²Is substituted 2 to 8 membered heteroalkyl substituted pyrrolidinyl. In the examples, R²Is a3 to 6 membered heterocycloalkyl substituted with tert-butoxycarbonyl. In the examples, R²Is a substituted 3-to 6-membered heterocycloalkyl group. In the examples, R²Is a substituted heterocycloalkyl group.

In the examples, R²Is unsubstituted 4-membered heteroalkyl. In the examples, R²Is unsubstituted 2-to 6-membered heteroalkyl. In the examples, R²Is unsubstituted heteroalkyl.

In the examples, R²Is unsubstituted cyclobutyl. In the examples, R²Is unsubstituted 3 to 6 membered cycloalkyl. In the examples, R²Is unsubstituted cycloalkyl.

In the examples, R²Is unsubstituted pyrrolidinyl. In the examples, R²Is unsubstituted 3-to 6-membered heterocycloalkyl. In the examples, R²Is unsubstituted heterocycloalkyl.

In the examples, R²Is cyclobutyl substituted by OH. In the examples, R²Is a substituted cyclobutyl group. In the examples, R²Is C substituted by OH₃-C₆A cycloalkyl group. In the examples, R²Is substituted C₃-C₆A cycloalkyl group.

In the examples, R²Is propyl substituted by OH. In the examples, R²Is C substituted by OH₁-C₆An alkyl group. In the examples, R²Is a substituted propyl group. In the examples, R²Is substituted C₁-C₆An alkyl group.

In the examples, R²Is azetidinyl substituted with tert-butoxycarbonyl. In the examples, R²Is 2 to 8 membered heteroalkyl substituted azetidinyl substituted with oxo. In the examples, R²Is an azetidinyl substituted with an oxo-substituted heteroalkyl. In the examples, R²Is a substituted 2-to 8-membered heteroalkyl substituted azetidinyl. In the examples, R²Is a substituted heteroalkyl substituted azetidinyl.

In the examples, R²Is unsubstituted cyclopentyl. In the examples, R²Is unsubstituted C₃-C₆A cycloalkyl group. In the examples, R²Is unsubstituted cyclopropyl.

In the examples, R²Is methyl substituted by unsubstituted cyclobutyl. In the examples, R²Is unsubstituted C₃-C₆Cycloalkyl-substituted methyl. In the examples, R²Is unsubstituted cyclobutyl substituted C₁-C₄An alkyl group. In the examples, R²Is unsubstituted C₃-C₆Cycloalkyl-substituted C₁-C₄An alkyl group.

In the examples, R²Is unsubstituted oxetanyl. In the examples, R²Is unsubstituted 3-to 6-membered heterocycloalkyl.

In the examples, R²Is unsubstituted isopropyl. In the examples, R²Is unsubstituted propyl. In the examples, R²Is unsubstituted tert-butyl. In the examples, R²Is an unsubstituted butyl group. In the examples, R²Is unsubstituted C₁-C₆An alkyl group.

In the examples, R²Is a 4-membered heteroalkyl substituted with oxo. In the examples, R²Is a2 to 6 membered heteroalkyl substituted with oxo. In the examples, R²Is a substituted 4-membered heteroalkyl group. In the examples, R²Is a substituted 2-to 6-membered heteroalkyl group. In the examples, R²Is a substituted heteroalkyl group.

In the examples, R²Is methyl substituted with unsubstituted tetrahydropyran. In the examples, R²Is methyl substituted with tetrahydropyran. In the examples, R²Is an unsubstituted 5-to 6-membered heterocycloalkyl substituted methyl group. In the examples, R²Is unsubstituted tetrahydropyran substituted C₁-C₄An alkyl group. In the examples, R²Is C substituted by tetrahydropyran₁-C₄An alkyl group. In the examples, R²Is unsubstituted 5-to 6-membered heterocycloalkyl-substituted C₁-C₄An alkyl group.

In the examples, R²Is by CF₃A substituted methyl group. In the examples, R²Is a quilt C (halogen base)₃A substituted methyl group. In the examples, R²Is by CF₃Substituted C₁-C₄An alkyl group. In the examples, R²Is a quilt C (halogen base)₃Substituted C₁-C₄An alkyl group.

In the examples, R²Is methyl substituted with t-butoxycarbonyl substituted pyrrolidinyl. In the examples, R²Is a pyrrolidinyl substituted methyl substituted with a2 to 8 membered heteroalkyl substituted with oxo. In the examples, R²Is a substituted 2 to 8 membered heteroalkyl substituted pyrrolidinyl substituted methyl. In the examples, R²Is methyl substituted with a3 to 6 membered heterocycloalkyl substituted with tert-butoxycarbonyl. In the examples, R²Is C substituted by tert-butoxycarbonyl-substituted pyrrolidinyl₁-C₄An alkyl group. In the examples, R²Is substituted 2-to 8-membered heteroalkyl-substituted pyrrolidinyl-substituted C₁-C₄An alkyl group. In the examples, R²Is a 3-to 6-membered heterocycloalkyl substituted with a substituted 2-to 8-membered heteroalkyl₁-C₄An alkyl group. In the examples, R²Is substituted with a substituted 3-to 6-membered heterocycloalkyl group₁-C₄An alkyl group.

In the examples, R²Is butyl substituted by OH. In the examples, R²Is a substituted butyl group.

In the examples, R²Is ethyl substituted with OH substituted pyridyl. In the examples, R²Is ethyl substituted by OH. In the examples, R²Is an ethyl group substituted with an unsubstituted pyridyl group. In the examples, R²Is C substituted by OH and unsubstituted pyridyl₁-C₄An alkyl group. In the examples, R²Is C substituted by OH₁-C₄An alkyl group. In the examples, R²Is unsubstituted pyridyl substituted C₁-C₄An alkyl group. In the examples, R²Is ethyl substituted with OH and unsubstituted 5-to 6-membered heteroaryl. In the examples, R²Is a substituted ethyl group. In the examples, R²Is an unsubstituted 5-to 6-membered heteroaryl substituted ethyl group. In the examples, R²Is taken out by OHSubstituted and unsubstituted 5-to 6-membered heteroaryl substituted C₁-C₄An alkyl group. In the examples, R²Is substituted C₁-C₄An alkyl group. In the examples, R²Is unsubstituted 5-to 6-membered heteroaryl substituted C₁-C₄An alkyl group.

In the examples, R²Is methyl substituted with imidazolyl substituted with substituted or unsubstituted methyl. In the examples, R²Is methyl substituted with a 5 to 6 membered heteroaryl substituted with substituted or unsubstituted methyl. In the examples, R²Is methyl substituted by heteroaryl substituted by substituted or unsubstituted methyl. In the examples, R²Is methyl substituted with a substituted methyl substituted imidazolyl. In the examples, R²Is a 5 to 6 membered heteroaryl substituted methyl substituted with a substituted methyl. In the examples, R²Is a substituted methyl-substituted heteroaryl-substituted methyl. In the examples, R²Is unsubstituted C₁-C₄Alkyl substituted imidazolyl substituted C₁-C₄An alkyl group. In the examples, R²Is unsubstituted C₁-C₄Alkyl substituted 5 to 6 membered heteroaryl substituted C₁-C₄An alkyl group. In the examples, R²Is unsubstituted C₁-C₄Alkyl substituted heteroaryl substituted C₁-C₄An alkyl group.

In the examples, R²Is cyclobutyl substituted by methoxy. In the examples, R²Is cyclobutyl substituted by 2-to 4-membered heteroalkyl. In the examples, R²Is C substituted by methoxy₃-C₆A cycloalkyl group. In the examples, R²Is C substituted by 2-to 4-membered heteroalkyl₃-C₆A cycloalkyl group.

In the examples, R²Is unsubstituted phenyl. In the examples, R²Is unsubstituted aryl.

In the examples, R²Is methyl substituted with a substituted or unsubstituted imidazolyl. In the examples, R²Is substituted or not substitutedSubstituted 5-to 6-membered heteroaryl substituted methyl. In the examples, R²Is methyl substituted with substituted or unsubstituted heteroaryl. In the examples, R²Is methyl substituted with a substituted imidazolyl group. In the examples, R²Is methyl substituted with a substituted 5-to 6-membered heteroaryl group. In the examples, R²Is methyl substituted with a substituted heteroaryl group. In the examples, R²Is methyl substituted with unsubstituted imidazolyl. In the examples, R²Is an unsubstituted 5-to 6-membered heteroaryl substituted methyl. In the examples, R²Is methyl substituted with unsubstituted heteroaryl. In the examples, R²Is C substituted by a substituted or unsubstituted imidazolyl group₁-C₄An alkyl group. In the examples, R²Is C substituted with a substituted or unsubstituted 5-to 6-membered heteroaryl group₁-C₄An alkyl group. In the examples, R²Is C substituted by substituted or unsubstituted heteroaryl₁-C₄An alkyl group. In the examples, R²Is unsubstituted imidazolyl-substituted C₁-C₄An alkyl group. In the examples, R²Is unsubstituted 5-to 6-membered heteroaryl substituted C₁-C₄An alkyl group. In the examples, R²Is unsubstituted heteroaryl substituted C₁-C₄An alkyl group.

In the examples, R²Is cyclopentyl substituted by OH. In the examples, R²Is C substituted by OH₃-C₆A cycloalkyl group. In the examples, R²Is a substituted cyclopentyl group. In the examples, R²Is substituted C₃-C₆A cycloalkyl group.

In the examples, R²Is ethyl substituted by OH-substituted phenyl. In the examples, R²Is ethyl substituted with an OH substituted aryl. In the examples, R²Is a substituted aryl substituted ethyl group. In the examples, R²Is C substituted by OH-substituted phenyl₁-C₄An alkyl group. In the examples, R²Is C substituted by OH-substituted aryl₁-C₄An alkyl group. In the examplesIn, R²Is substituted by substituted aryl₁-C₄An alkyl group.

In the examples, R²Is ethyl substituted with t-butoxycarbonyl substituted tetrahydropyran. In the examples, R²Is a substituted 2 to 8 membered heteroalkyl substituted tetrahydropyran substituted ethyl group. In the examples, R²Is ethyl substituted with a3 to 6 membered heterocycloalkyl substituted with tert-butoxycarbonyl. In the examples, R²Is C substituted by tetrahydropyran substituted by tert-butoxycarbonyl₁-C₄An alkyl group.

In the examples, R²Is an unsubstituted pyrrolidinyl-substituted ethyl group. In the examples, R²Is an unsubstituted 3-to 6-membered heterocycloalkyl substituted ethyl group. In the examples, R²Is unsubstituted pyrrolidinyl substituted C₁-C₄An alkyl group. In the examples, R²Is unsubstituted 5-to 6-membered heterocycloalkyl-substituted C₁-C₄An alkyl group.

In the examples, R²Is ethyl substituted with t-butoxycarbonyl substituted pyrrolidinyl. In the examples, R²Is a substituted 2 to 8 membered heteroalkyl substituted pyrrolidinyl substituted ethyl. In the examples, R²Is ethyl substituted with a3 to 6 membered heterocycloalkyl substituted with tert-butoxycarbonyl.

In the examples, R²Is C substituted by tert-butoxycarbonyl-substituted pyrrolidinyl₁-C₄An alkyl group. In the examples, R²Is substituted 2-to 8-membered heteroalkyl-substituted pyrrolidinyl-substituted C₁-C₄An alkyl group. In the examples, R²Is C substituted by a 3-to 6-membered heterocycloalkyl group substituted by a tert-butoxycarbonyl group₁-C₄An alkyl group.

In the examples, R²Is methyl substituted by unsubstituted pyrrolidinyl. In the examples, R²Is an unsubstituted 3-to 6-membered heterocycloalkyl substituted methyl group.

In the examples, R²Is unsubstituted pyrrolidinyl substituted C₁-C₄An alkyl group. In the examples, R²Is unsubstituted 3-to 6-membered heterocycloalkyl-substituted C₁-C₄An alkyl group.

In the examples, R²Is ethyl substituted with unsubstituted morpholinyl. In the examples, R²Is ethyl substituted with unsubstituted morpholinyl. In the examples, R²Is an unsubstituted 5-to 6-membered heterocycloalkyl substituted ethyl group. In the examples, R²Is unsubstituted morpholinyl substituted C₁-C₄An alkyl group.

In the examples, R²Is ethyl substituted by OH-substituted phenyl. In the examples, R²Is ethyl substituted with an OH substituted aryl. In the examples, R²Is substituted by substituted phenyl₁-C₄An alkyl group. In the examples, R²Is substituted by substituted aryl₁-C₄An alkyl group.

In the examples, R²Is unsubstituted piperidinyl substituted methyl. In the examples, R²Is an unsubstituted 5-to 6-membered heterocycloalkyl substituted methyl group. In the examples, R²Is an unsubstituted heterocycloalkyl substituted methyl group. In the examples, R²Is unsubstituted piperidinyl-substituted C₁-C₄An alkyl group. In the examples, R²Is unsubstituted 5-to 6-membered heterocycloalkyl-substituted C₁-C₄An alkyl group. In the examples, R²Is unsubstituted heterocycloalkyl-substituted C₁-C₄An alkyl group.

In the examples, R²Is an ethyl group substituted with an OH-substituted methyl-substituted phenyl group. In the examples, R²Is an ethyl group substituted with an aryl group substituted with an OH-substituted methyl group. In the examples, R²Is a substituted phenyl substituted ethyl group. In the examples, R²Is a substituted aryl substituted ethyl group. In the examples, R²Is substituted by substituted phenyl₁-C₄An alkyl group. In the examples, R²Is substituted by substituted aryl₁-C₄An alkyl group.

In the examples, R²Is ethyl substituted with Cl substituted phenyl. In the examples, R²Is an ethyl group substituted with an aryl group substituted with a halogen group. In the examples, R²Is ethyl substituted with phenyl substituted with halo. In the examples, R²Is C substituted by Cl-substituted phenyl₁-C₄An alkyl group. In the examples, R²Is C substituted by phenyl substituted by halogen₁-C₄An alkyl group. In the examples, R²Is aryl substituted by halogen₁-C₄An alkyl group.

In the examples, R²Is methyl substituted with unsubstituted tetrahydrofuranyl. In the examples, R²Is methyl substituted by tetrahydrofuranyl. In the examples, R²Is an unsubstituted 3-to 6-membered heterocycloalkyl substituted methyl group. In the examples, R²Is unsubstituted tetrahydrofuranyl-substituted C₁-C₄An alkyl group. In the examples, R²Is C substituted by tetrahydrofuranyl₁-C₄An alkyl group.

In the examples, R²Is an ethyl group substituted with an unsubstituted phenyl group. In the examples, R²Is an unsubstituted aryl substituted ethyl group. In the examples, R²Is unsubstituted phenyl-substituted C₁-C₄An alkyl group. In the examples, R²Is unsubstituted aryl-substituted C₁-C₄An alkyl group.

In the examples, R²Is unsubstituted azetidinyl. In the examples, R²Is unsubstituted 3-to 6-membered heterocycloalkyl

In the examples, R²Is methyl substituted by phenoxy substituted by methoxy. In the examples, R²Is methyl substituted with 2 to 4-membered alkoxy substituted phenoxy substituted pyridyl. In the examples, R²Is methyl substituted with 2 to 4-membered alkoxy-substituted aryloxy-substituted pyridyl. In the examples, R²Is methyl substituted with 5 to 6 membered heteroaryl substituted with 2 to 4 membered alkoxy substituted aryloxy. In the implementation ofIn the examples, R²Is C substituted with a 5-to 6-membered heteroaryl group substituted with a 2-to 4-membered alkoxy-substituted aryloxy group₁-C₄An alkyl group.

In the examples, R²Is ethyl substituted with methoxy substituted pyridyl. In the examples, R²Is ethyl substituted with 2 to 4 membered alkoxy substituted pyridyl. In the examples, R²Is ethyl substituted with a 5 to 6 membered heteroaryl substituted with a2 to 4 membered alkoxy. In the examples, R²Is C substituted with a 5-to 6-membered heteroaryl group substituted with a 2-to 4-membered alkoxy group₁-C₄An alkyl group. In the examples, R²Is C substituted by 2-to 4-membered alkoxy-substituted heteroaryl₁-C₄An alkyl group.

In the examples, R²Is ethyl substituted by methoxy substituted phenyl. In the examples, R²Is ethyl substituted with phenyl substituted with 2 to 4 membered alkoxy. In the examples, R²Is ethyl substituted with 2 to 4 membered alkoxy substituted aryl. In the examples, R²Is C substituted by aryl substituted by 2-to 4-membered alkoxy₁-C₄An alkyl group.

In the examples, R²Is ethyl substituted with phenyl substituted with a2 to 4 membered heteroalkyl substituted with oxo. In the examples, R²Is a substituted 2 to 4 membered heteroalkyl substituted phenyl substituted ethyl. In the examples, R²Is ethyl substituted with 2 to 4 membered heteroalkyl substituted aryl. In the examples, R²Is substituted 2-to 4-membered heteroalkyl-substituted aryl-substituted C₁-C₄An alkyl group.

In the examples, R²Is propyl substituted with methoxy substituted phenyl. In the examples, R²Is a propyl group substituted with a phenyl group substituted with a2 to 4-membered alkoxy group. In the examples, R²Is a propyl group substituted with a2 to 4-membered alkoxy-substituted aryl group. In the examples, R²Is C substituted by aryl substituted by 2-to 4-membered alkoxy₁-C₄An alkyl group.

In the examples, R²Is 2-to 4-membered heteroalkyl substituted with oxoPhenyl substituted ethyl. In the examples, R²Is a substituted 2 to 4 membered heteroalkyl substituted phenyl substituted ethyl. In the examples, R²Is ethyl substituted with 2 to 4 membered heteroalkyl substituted aryl. In the examples, R²Is substituted 2-to 4-membered heteroalkyl-substituted aryl-substituted C₁-C₄An alkyl group.

In the examples, R²Is an ethyl group substituted with an unsubstituted cyclopentyl group. In the examples, R²Is unsubstituted C₃-C₆Cycloalkyl-substituted ethyl. In the examples, R²Is unsubstituted C₃-C₆Cycloalkyl-substituted C₁-C₄An alkyl group.

In the examples, R²Is ethyl substituted with t-butoxycarbonyl substituted pyrrolidinyl. In the examples, R²Is a pyrrolidinyl substituted ethyl substituted with oxo substituted 4 to 8 membered heteroalkyl substituted. In the examples, R²Is a substituted 4 to 8 membered heteroalkyl substituted pyrrolidinyl substituted ethyl. In the examples, R²Is a3 to 6 membered heterocycloalkyl substituted ethyl substituted with a substituted 4 to 8 membered heteroalkyl. In the examples, R²Is a 3-to 6-membered heterocycloalkyl substituted with a substituted 4-to 8-membered heteroalkyl₁-C₄An alkyl group.

In the examples, R²Is ethyl substituted with t-butoxycarbonyl substituted azetidinyl. In the examples, R²Is an ethyl group substituted with an oxo-substituted 4 to 8 membered heteroalkyl-substituted azetidinyl group. In the examples, R²Is a substituted 4 to 8 membered heteroalkyl substituted azetidinyl substituted ethyl. In the examples, R²Is a substituted 4-to 8-membered heteroalkyl-substituted azetidinyl-substituted C₁-C₄An alkyl group.

In the examples, R²Is an ethyl group substituted with an unsubstituted azetidinyl group. In the examples, R²Is unsubstituted C₃-C₆Heterocycloalkyl substituted ethyl. In the examples, R²Is unsubstituted C₃-C₆Heterocycloalkyl-substituted C₁-C₄An alkyl group.

In the examples, R²Is ethyl substituted with phenyl substituted with CN. In the examples, R²Is a substituted phenyl substituted ethyl group. In the examples, R²Is ethyl substituted with aryl substituted with CN. In the examples, R²Is aryl substituted by CN₁-C₄An alkyl group. In the examples, R²Is substituted by substituted aryl₁-C₄An alkyl group.

In the examples, R²Is an unsubstituted phenyl-substituted ethyl-substituted piperidinyl-substituted methyl group. In the examples, R²Is an unsubstituted aryl-substituted ethyl-substituted piperidinyl-substituted methyl group. In the examples, R²Is unsubstituted aryl-substituted C₁-C₄Alkyl-substituted piperidinyl-substituted methyl. In the examples, R²Is unsubstituted aryl-substituted C₁-C₄Alkyl-substituted 3 to 6 membered heterocycloalkyl-substituted methyl. In the examples, R²Is unsubstituted aryl-substituted C₁-C₄Alkyl substituted 3 to 6 membered heterocycloalkyl substituted C₁-C₄An alkyl group.

In the examples, R²Is methyl substituted by methoxy substituted pyridyl. In the examples, R²Is methyl substituted with 2 to 4-membered alkoxy substituted pyridyl. In the examples, R²Is methyl substituted with a 5 to 6 membered heteroaryl substituted with a2 to 4 membered alkoxy. In the examples, R²Is C substituted with a 5-to 6-membered heteroaryl group substituted with a 2-to 4-membered alkoxy group₁-C₄An alkyl group.

In the examples, R²Is methyl substituted by unsubstituted 2-to 4-membered alkoxy-substituted pyridyl. In the examples, R²Is an unsubstituted 2-to 4-membered alkoxy-substituted 5-to 6-membered heteroaryl-substituted methyl group. In the examples, R²Is unsubstituted 2-to 4-membered alkoxy-substituted 5-to 6-membered heteroaryl-substituted C₁-C₄An alkyl group.

In the examples, R²Is methyl substituted by unsubstituted pyridyl. In the examples, R²Is an unsubstituted 5-to 6-membered heteroaryl substituted methyl. In the examples, R²Is unsubstituted 5-to 6-membered heteroaryl substituted C₁-C₄An alkyl group.

In the examples, R²Is ethyl substituted by phenyl substituted by carboxyl. In the examples, R²Is a substituted phenyl substituted ethyl group. In the examples, R²Is ethyl substituted with aryl substituted with carboxyl. In the examples, R²Is aryl substituted by carboxyl₁-C₄An alkyl group.

In the examples, R²Is by SO₂NH₂Substituted phenyl substituted ethyl. In the examples, R²Is by SO₂NH₂Substituted aryl substituted ethyl. In the examples, R²Is by SO₂NH₂Substituted aryl substituted C₁-C₄An alkyl group. In the examples, R²Is hydrogen.

In the examples, R²Is ethyl substituted with phenyl substituted with tert-butyl carbamate. In the examples, R²Is an ethyl group substituted with a phenyl group substituted with a 6 to 8 membered heteroalkyl group substituted with an oxo group. In the examples, R²Is a substituted 6 to 8 membered heteroalkyl substituted phenyl substituted ethyl. In the examples, R²Is a substituted 6 to 8 membered heteroalkyl substituted aryl substituted ethyl. In the examples, R²Is substituted 6-to 8-membered heteroalkyl-substituted aryl-substituted C₁-C₄An alkyl group.

In the examples, R²Is ethyl substituted with tert-butoxycarbonyl substituted piperidinyl. In the examples, R²Is a piperidinyl-substituted ethyl substituted with a 5 to 7 membered heteroalkyl substituted with oxo. In the examples, R²Is a substituted 5 to 7 membered heteroalkyl substituted piperidinyl substituted ethyl. In the examples, R²Is a 5 to 6 membered heterocycloalkyl substituted ethyl substituted with a substituted 5 to 7 membered heteroalkyl. In thatIn the examples, R²Is a 5-to 6-membered heterocycloalkyl substituted with a substituted 5-to 7-membered heteroalkyl₁-C₄An alkyl group.

In the examples, R²Is methyl substituted by unsubstituted thiazolyl. In the examples, R²Is an unsubstituted 5-to 6-membered heteroaryl substituted methyl. In the examples, R²Is unsubstituted 5-to 6-membered heteroaryl substituted C₁-C₄An alkyl group.

In the examples, R²Is by NH₂Substituted phenyl substituted ethyl. In the examples, R²Is by NH₂Substituted aryl substituted ethyl. In the examples, R²Is by NH₂Substituted aryl substituted C₁-C₄An alkyl group. In the examples, R²Is substituted by substituted aryl₁-C₄An alkyl group.

In the examples, R²Is an unsubstituted piperidinyl-substituted ethyl group. In the examples, R²Is an unsubstituted 5-to 6-membered heterocycloalkyl substituted ethyl group. In the examples, R²Is unsubstituted 5-to 6-membered heterocycloalkyl-substituted C₁-C₄An alkyl group.

In the examples, R²Is ethyl substituted with phenyl substituted with a2 to 6 membered heteroalkyl substituted with oxo. In the examples, R²Is a substituted 2 to 6 membered heteroalkyl substituted phenyl substituted ethyl. In the examples, R²Is a substituted 2 to 6 membered heteroalkyl substituted aryl substituted ethyl. In the examples, R²Is substituted 2-to 6-membered heteroalkyl-substituted aryl-substituted C₁-C₄An alkyl group.

In the examples, R²Is thatIn the examples, R²Is thatIn the examples, R²Is thatIn the examples, R²Is thatIn the examples, R²Is that

In the examples, R²Is that

In the examples, R²Is thatIn the examples, R²Is thatIn the examples, R²Is thatIn the examples, R²Is that

In the examples, R²Is that

In the examples, R²Is thatIn the examples, R²Is thatIn the examples, R²Is that

In the examples, R²Is thatIn the examples, R²Is that

In the examples, R²Is that

In the examples, R²Is thatIn the examples, R²Is thatIn the examples, R²Is thatIn the examples, R²Is thatIn the examples, R²Is thatIn the examples, R²Is that

In the examples, R²Is thatIn the examples, R²Is thatIn the examples, R²Is that

In the examples, R²Is thatIn the examples, R²Is that

In the examples, R²Is thatIn the examples, R²Is thatIn the examples, R²Is thatIn the examples, R²Is thatIn the examples, R²Is that

In the examples, R²Is thatIn the examples, R²Is thatIn the examples, R²Is that

In the examples, R²Is that

In the examples, R²Is thatIn the examples, R²Is that

In the examples, R²Is thatIn the examples, R²Is thatIn the examples, R²Is that

In the examples, R²Is thatIn the examples, R²Is that

In the examples, R²Is thatIn the examples, R²Is thatIn the examples, R²Is that

In the examples, R²Is that

In the examples, R²Is thatIn the examples, R²Is that

In the examples, R²Is thatIn the examples, R²Is thatIn the examples, R²Is thatIn the examples, R²Is that

In the examples, R²Is thatIn the examples, R²Is that

In the examples, R²Is that

In the examples, R²Is thatIn the examples, R²Is that

In the examples, R²Is that

In the examples, R²Is thatIn the examples, R²Is thatIn the examples, R²Is that

In the examples, R²Is that

In the examplesIn, R²Is thatIn the examples, R²Is thatIn the examples, R²Is thatIn the examples, R²Is that

In the examples, R²Is that

In the examples, R²Is thatIn the examples, R²Is that

In the examples, R²Is thatIn the examples, R²Is thatIn the examples, R²Is that

In the examples, R²Is thatIn the examples, R²Is that

In the examples, R²Is that

In the examples, R²Is thatIn the examples, R²Is thatIn the examples, R²Is thatIn the examples, R²Is that

In the examples, R²Is that

In the examples, R²Is thatIn the examples, R²Is that

In the examples, R²Is that

In the examples, R²Is thatIn the examples, R²Is thatIn the examples, R²Is that

In the examples, R²Is that

In the examples, R²Is thatIn the examples, R²Is that

In the examples, R²Is that

In the examples, R²Is thatIn the examples, R²Is thatIn the examples, R²Is that

In the examples, R²Is that

In the examples, R²Is thatIn the examples, R²Is thatIn the examples, R²Is that

In the examples, R²Is that

In the examples, R²Is thatIn the examples, R²Is that

In the examples, R²Is thatIn the examples, R²Is thatIn the examples, R²Is thatIn the examples, R²Is that

In the examples, R²Is that

In the examples, R²Is thatIn the examples, R²Is that

In the examples, R²Is that

In the examples, R²Is thatIn the examples, R²Is that

In the examples, R³Is hydrogen, substituted or unsubstituted C₁-C₆Alkyl, substituted or unsubstituted 2-to 6-membered heteroalkyl, substituted or unsubstituted C₃-C₆Cycloalkyl radicalsSubstituted or unsubstituted 3-to 6-membered heterocycloalkyl, substituted or unsubstituted phenyl, or substituted or unsubstituted 5-to 6-membered heteroaryl.

In the examples, R³Independently is hydrogen, is R²⁶Substituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl), by R²⁶Substituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl), with R²⁶Substituted or unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl), by R²⁶Substituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl), with R²⁶Substituted or unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl) or by R²⁶Substituted or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl). In the examples, R³Independently hydrogen.

In the examples, R³Is by R²⁶Substituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R³Is by R²⁶Substituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R³Is unsubstituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R³Is by R²⁶Substituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R³Is by R²⁶Substituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R³Is not coveredSubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R³Is by R²⁶Substituted or unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups). In the examples, R³Is by R²⁶Substituted cycloalkyl (e.g. C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups). In the examples, R³Is unsubstituted cycloalkyl (e.g. C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups). In the examples, R³Is by R²⁶Substituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl). In the examples, R³Is by R²⁶Substituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl). In the examples, R³Is unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl). In the examples, R³Is by R²⁶Substituted or unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl). In the examples, R³Is by R²⁶Substituted aryl radicals (e.g. C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl). In the examples, R³Is unsubstituted aryl (e.g. C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl). In the examples, R³Is by R²⁶Substituted or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl). In the examples, R³Is by R²⁶Substituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl). In the examples, R³Is unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl).

In the examples, R²⁶Independently an oxo group. In the examples, R²⁶Independently a halogen. In the examples, R²⁶Independently is-CCl₃. In the examples, R²⁶Independently is-CBr₃. In the examples, R²⁶Independently is-CF₃. In the examples, R²⁶Independently is-CI₃. In the examples, R²⁶Independently is CHCl₂. In the examples, R²⁶Independently is-CHBr₂. In the examples, R²⁶Independently is-CHF₂. In the examples, R²⁶Independently is-CHI₂. In the examples, R²⁶Independently is-CH₂And (4) Cl. In the examples, R²⁶Independently is-CH₂Br is added. In the examples, R²⁶Independently is-CH₂F. In the examples, R²⁶Independently is-CH₂I. In the examples, R²⁶Independently is-CN. In the examples, R²⁶Independently is-OH. In the examples, R²⁶Independently is-NH₂. In the examples, R²⁶independently-COOH. In the examples, R²⁶Independently is-CONH₂. In the examples, R²⁶Independently is-NO₂. In the examples, R²⁶Independently is-SH. In the examples, R²⁶Independently is-SO₃H. In the examples, R²⁶Independently is-SO₄H. In the examples, R²⁶Independently is-SO₂NH₂. In the examples, R²⁶Independently is-NHNH₂. In the examples, R²⁶Independently is-ONH₂. In the examples, R²⁶Independently is-NHC (O) NHNH₂. In the examples, R²⁶Independently is-NHC (O) NH₂. In the examples, R²⁶Independently is-NHSO₂H. In the examples, R²⁶independently-NHC (O) H. In the examples, R²⁶independently-NHC (O) OH. In the examples, R²⁶independently-NHOH. In the examples, R²⁶Independently is-OCCl₃. In the examples, R²⁶Independently is-OCF₃. In the examples, R²⁶Independently is-OCBr₃. In the examples, R²⁶Independently is-OCI₃. In the examples, R²⁶Independently is-OCHCl₂. In the examples, R²⁶Independently is-OCHBr₂. In the examples, R²⁶Independently is-OCHI₂. In the examples, R²⁶Independently is-OCHF₂. In the examples, R²⁶Independently is-OCH₂And (4) Cl. In the examples, R²⁶Independently is-OCH₂Br is added. In the examples, R²⁶Independently is-OCH₂I. In the examples, R²⁶Independently is-OCH₂F. In the examples, R²⁶Independently is-N₃。

In the examples, R²⁶Is by R²⁷Substituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R²⁶Is by R²⁷Substituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R²⁶Is unsubstituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups).

In the examples, R²⁶Is by R²⁷Substituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R²⁶Is by R²⁷Substituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R²⁶Is unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl).

In the examples, R²⁶Is by R²⁷Substituted or unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆CycloalkanesA base). In the examples, R²⁶Is by R²⁷Substituted cycloalkyl (e.g. C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups). In the examples, R²⁶Is unsubstituted cycloalkyl (e.g. C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups).

In the examples, R²⁶Is by R²⁷Substituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl). In the examples, R²⁶Is by R²⁷Substituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl). In the examples, R²⁶Is unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl).

In the examples, R²⁶Is by R²⁷Substituted or unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl). In the examples, R²⁶Is by R²⁷Substituted aryl radicals (e.g. C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl). In the examples, R²⁶Is unsubstituted aryl (e.g. C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl).

In the examples, R²⁶Is by R²⁷Substituted or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl). In the examples, R²⁶Is by R²⁷Substituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl). In the examples, R²⁶Is unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl).

R²⁶Independently oxo, halogen, -CCl₃、-CBr₃、-CF₃、-CI₃、CHCl₂、-CHBr₂、-CHF₂、-CHI₂、-CH₂Cl、-CH₂Br、-CH₂F、-CH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂、-NHC(O)NH₂、-NHSO₂H、-NHC(O)H、-NHC(O)OH、-NHOH、-OCCl₃、-OCF₃、-OCBr₃、-OCI₃、-OCHCl₂、-OCHBr₂、-OCHI₂、-OCHF₂、-OCH₂Cl、-OCH₂Br、-OCH₂I、-OCH₂F、-N₃Quilt R²⁷Substituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl), by R²⁷Substituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl), with R²⁷Substituted or unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl), by R²⁷Substituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl), with R²⁷Substituted or unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl) or by R²⁷Substituted or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl).

R²⁷Independently oxo, halogen, -CCl₃、-CBr₃、-CF₃、-CI₃、CHCl₂、-CHBr₂、-CHF₂、-CHI₂、-CH₂Cl、-CH₂Br、-CH₂F、-CH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂、-NHC(O)NH₂、-NHSO₂H、-NHC(O)H、-NHC(O)OH、-NHOH、-OCCl₃、-OCF₃、-OCBr₃、-OCI₃、-OCHCl₂、-OCHBr₂、-OCHI₂、-OCHF₂、-OCH₂Cl、-OCH₂Br、-OCH₂I、-OCH₂F、-N₃Quilt R²⁸Substituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl), by R²⁸Substituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl), with R²⁸Substituted or unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl), by R²⁸Substituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl), with R²⁸Substituted or unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl) or by R²⁸Substituted or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl). In the examples, R²⁷Independently is-OH. In the examples, R²⁷Independently is-OCH₃. In the examples, R²⁷Independently is-OCH₂CH₃. In the examples, R²⁷Independently is-F. In the examples, R²⁷Independently is-NHC (O) CH₃. In the examples, R²⁷independently-COOH. In the examples, R²⁷Independently is-SO₂NH₂。

In the examples, R²And R³May optionally be joined to form a substituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl), which may be referred to herein as "ring B". In the examples, R²And R³May optionally be joined to form a substituted or unsubstituted 3-to 8-membered heterocycloalkyl. In the examples, R²And R³May optionally be joined to form a substituted or unsubstituted 3-membered heterocycloalkyl. In the examples, R²And R³May optionally be joined to form a substituted or unsubstituted 4-membered heterocycloalkyl. In the examples, R²And R³May optionally be joined to form a substituted or unsubstituted 5-membered heterocycloalkyl. In the examples, R²And R³May optionally be joined to form a substituted or unsubstituted 6-membered heterocycloalkyl. In the examples, R²And R³May optionally be joined to form a substituted or unsubstituted 7-membered heterocycloalkyl. In the examples, R²And R³May optionally be joined to form a substituted or unsubstituted 8-membered heterocycloalkyl.

In the examples, R²And R³May optionally be joined to form a substituted 3-to 8-membered heterocycloalkyl group. In the examples, R²And R³May optionally be joined to form a substituted 3-membered heterocycloalkyl group. In the examples, R²And R³May optionally be joined to form a substituted 4-membered heterocycloalkyl group. In the examples, R²And R³May optionally be joined to form a substituted 5-membered heterocycloalkyl group. In the examples, R²And R³May optionally be joined to form a substituted 6-membered heterocycloalkyl group. In the examples, R²And R³May optionally be joined to form a substituted 7-membered heterocycloalkyl group. In the examples, R²And R³May optionally be joined to form a substituted 8-membered heterocycloalkyl group. In the examples, R²And R³Optionally joined to form a quilt R⁶Substituted 3 to 8 membered heterocycloalkyl. In the examples, R²And R³Optionally joined to form a quilt R⁶Substituted 3-membered heterocycloalkyl. In the examples, R²And R³Optionally joined to form a quilt R⁶Substituted 4-membered heterocycloalkyl. In the examples, R²And R³Optionally joined to form a quilt R⁶Substituted 5-membered heterocycloalkyl. In the examples, R²And R³Optionally joined to form a quilt R⁶Substituted 6-membered heterocycloalkyl. In thatIn the examples, R²And R³Optionally joined to form a quilt R⁶Substituted 7-membered heterocycloalkyl. In the examples, R²And R³Optionally joined to form a quilt R⁶Substituted 8-membered heterocycloalkyl. In the examples, R²And R³May optionally be joined to form an unsubstituted 3-to 8-membered heterocycloalkyl group. In the examples, R²And R³May optionally be joined to form an unsubstituted 3-membered heterocycloalkyl group. In the examples, R²And R³May optionally be joined to form an unsubstituted 4-membered heterocycloalkyl group. In the examples, R²And R³May optionally be joined to form an unsubstituted 5-membered heterocycloalkyl group. In the examples, R²And R³May optionally be joined to form an unsubstituted 6-membered heterocycloalkyl group. In the examples, R²And R³May optionally be joined to form an unsubstituted 7-membered heterocycloalkyl group. In the examples, R²And R³May optionally be joined to form an unsubstituted 8-membered heterocycloalkyl group.

In the examples, R³Is hydrogen, substituted or unsubstituted C₁-C₆Alkyl, substituted or unsubstituted 2-to 6-membered heteroalkyl, substituted or unsubstituted C₃-C₆Cycloalkyl, substituted or unsubstituted 3-to 6-membered heterocycloalkyl, substituted or unsubstituted phenyl, or substituted or unsubstituted 5-to 6-membered heteroaryl. In the examples, R²And R³To form a substituted or unsubstituted heterocycloalkyl.

In the examples, R³Is by R²⁶Substituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R³Is by R²⁶Substituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R³Is unsubstituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R³Is by R²⁶Substituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R³Is by R²⁶Substituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R³Is unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R³Is by R²⁶Substituted or unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups). In the examples, R³Is by R²⁶Substituted cycloalkyl (e.g. C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups). In the examples, R³Is unsubstituted cycloalkyl (e.g. C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups). In the examples, R³Is by R²⁶Substituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl). In the examples, R³Is by R²⁶Substituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl). In the examples, R³Is unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl). In the examples, R³Is by R²⁶Substituted or unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl). In the examples, R³Is by R²⁶Substituted aryl radicals (e.g. C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl). In the examples, R³Is unsubstituted aryl (e.g. C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl). In the examples, R³Is by R²⁶Substituted or unsubstituted heteroaryl (e.g.5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl). In the examples, R³Is by R²⁶Substituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl). In the examples, R³Is unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl). In the examples, R³Is substituted or unsubstituted C₁-C₆An alkyl group. In the examples, R³Is substituted or unsubstituted C₃-C₆A cycloalkyl group. In the examples, R³Is hydrogen.

In the examples, R³Is ethyl substituted with substituted or unsubstituted pyridyl. In the examples, R³Is ethyl substituted with a substituted or unsubstituted 5-to 6-membered heteroaryl. In the examples, R³Is ethyl substituted with substituted or unsubstituted heteroaryl. In the examples, R³Is C substituted with a substituted or unsubstituted 5-to 6-membered heteroaryl group₁-C₄An alkyl group. In the examples, R³Is C substituted by substituted or unsubstituted heteroaryl₁-C₄An alkyl group. In the examples, R³Is ethyl substituted with a substituted pyridyl group. In the examples, R³Is ethyl substituted with a substituted 5-to 6-membered heteroaryl. In the examples, R³Is ethyl substituted with a substituted heteroaryl group. In the examples, R³Is substituted with a substituted 5-to 6-membered heteroaryl group₁-C₄An alkyl group. In the examples, R³Is substituted with substituted heteroaryl₁-C₄An alkyl group. In the examples, R³Is substituted C₁-C₄An alkyl group. In the examples, R³Is a substituted ethyl group. In the examples, R³Is an ethyl group substituted with an unsubstituted pyridyl group. In the examples, R³Is an unsubstituted 5-to 6-membered heteroaryl substituted ethyl group. In the examples, R³Is an unsubstituted heteroaryl substituted ethyl. In the examples, R³Is unsubstituted 5-to 6-membered heteroaryl substituted C₁-C₄An alkyl group. In the examplesIn, R³Is unsubstituted heteroaryl substituted C₁-C₄An alkyl group.

In the examples, R³Is methyl substituted by substituted or unsubstituted pyrimidinyl. In the examples, R³Is methyl substituted with a substituted or unsubstituted 5-to 6-membered heteroaryl. In the examples, R³Is methyl substituted with substituted or unsubstituted heteroaryl. In the examples, R³Is methyl substituted with a substituted pyrimidinyl group. In the examples, R³Is methyl substituted with a substituted 5-to 6-membered heteroaryl group. In the examples, R³Substituted heteroaryl substituted methyl. In the examples, R³Is a substituted methyl group. In the examples, R³Is substituted C₁-C₄An alkyl group. In the examples, R³Is an unsubstituted pyrimidinyl-substituted methyl group. In the examples, R³Is an unsubstituted 5-to 6-membered heteroaryl substituted methyl. In the examples, R³Is methyl substituted with unsubstituted heteroaryl.

In the examples, R³Is methyl substituted by substituted or unsubstituted pyridyl. In the examples, R³Is methyl substituted by methoxy substituted pyridyl. In the examples, R³Is methyl substituted with a substituted pyridyl group. In the examples, R³Is methyl substituted by unsubstituted pyridyl.

In the examples, R³Is C substituted by methoxy-substituted pyridyl₁-C₄An alkyl group. In the examples, R³Is substituted by a substituted pyridyl group₁-C₄An alkyl group. In the examples, R³Is unsubstituted pyridyl substituted C₁-C₄An alkyl group. In the examples, R³Is substituted with a substituted 5-to 6-membered heteroaryl group₁-C₄An alkyl group. In the examples, R³Is substituted with substituted heteroaryl₁-C₄An alkyl group.

In the examples, R³Is unsubstituted methyl. In the examples, R³Is unsubstitutedC₁-C₄An alkyl group. In the examples, R³Is cyclopentyl substituted with substituted or unsubstituted methyl. In the examples, R³Is substituted or unsubstituted C₁-C₄Alkyl-substituted cyclopentyl. In the examples, R³Is C substituted by substituted or unsubstituted methyl₃-C₆A cycloalkyl group. In the examples, R³Is a substituted methyl-substituted cyclopentyl group. In the examples, R³Is substituted C₁-C₄Alkyl-substituted cyclopentyl. In the examples, R³Is substituted by substituted methyl₃-C₆A cycloalkyl group. In the examples, R³Is substituted C₃-C₆A cycloalkyl group. In the examples, R³Is a substituted cyclopentyl group.

In the examples, R³Is propyl substituted with substituted or unsubstituted pyridyl. In the examples, R³Is a substituted or unsubstituted 5-to 6-membered heteroaryl substituted propyl. In the examples, R³Is propyl substituted with substituted or unsubstituted heteroaryl. In the examples, R³Is a substituted propyl group. In the examples, R³Is C substituted by substituted or unsubstituted pyridyl₁-C₆An alkyl group. In the examples, R³Is propyl substituted with a substituted pyridyl group. In the examples, R³Is a substituted 5-to 6-membered heteroaryl substituted propyl. In the examples, R³Is a substituted heteroaryl substituted propyl. In the examples, R³Is unsubstituted propyl. In the examples, R³Is substituted by a substituted pyridyl group₁-C₆An alkyl group. In the examples, R³Is propyl substituted with unsubstituted pyridyl. In the examples, R³Is an unsubstituted 5-to 6-membered heteroaryl substituted propyl. In the examples, R³Is an unsubstituted heteroaryl substituted propyl. In the examples, R³Is unsubstituted pyridyl substituted C₁-C₆An alkyl group.

In the examples, R³Is taken outSubstituted or unsubstituted 5-to 6-membered heteroaryl substituted C₁-C₆An alkyl group. In the examples, R³Is C substituted by substituted or unsubstituted heteroaryl₁-C₆An alkyl group. In the examples, R³Is substituted with a substituted 5-to 6-membered heteroaryl group₁-C₆An alkyl group. In the examples, R³Is substituted with substituted heteroaryl₁-C₆An alkyl group. In the examples, R³Is substituted with a substituted 5-to 6-membered heteroaryl group₁-C₆An alkyl group. In the examples, R³Is substituted with substituted heteroaryl₁-C₆An alkyl group. In the examples, R³Is unsubstituted 5-to 6-membered heteroaryl substituted C₁-C₆An alkyl group. In the examples, R³Is unsubstituted heteroaryl substituted C₁-C₆An alkyl group. In the examples, R³Is substituted C₁-C₆An alkyl group. In the examples, R³Is propyl substituted with unsubstituted pyridyl. In the examples, R³Is an unsubstituted 5-to 6-membered heteroaryl substituted propyl. In the examples, R³Is an unsubstituted heteroaryl substituted propyl. In the examples, R³Is a substituted propyl group. In the examples, R³Is unsubstituted pyridyl substituted C₁-C₆An alkyl group. In the examples, R³Is unsubstituted 5-to 6-membered heteroaryl substituted C₁-C₆An alkyl group. In the examples, R³Is unsubstituted heteroaryl substituted C₁-C₆An alkyl group.

In the examples, R³Is methyl substituted with substituted or unsubstituted phenyl. In the examples, R³Is methyl substituted with substituted or unsubstituted aryl. In the examples, R³Is a substituted methyl group. In the examples, R³Is C substituted by substituted or unsubstituted phenyl₁-C₄An alkyl group. In the examples, R³Is C substituted by substituted or unsubstituted aryl₁-C₄An alkyl group. In the examples, R³Is substitutedPhenyl-substituted methyl. In the examples, R³Is methyl substituted with substituted aryl. In the examples, R³Is unsubstituted methyl. In the examples, R³Is substituted by substituted phenyl₁-C₄An alkyl group. In the examples, R³Is substituted by substituted aryl₁-C₄An alkyl group. In the examples, R³Is substituted C₁-C₄An alkyl group. In the examples, R³Is methyl substituted by unsubstituted phenyl. In the examples, R³Is an unsubstituted aryl-substituted methyl group. In the examples, R³Is unsubstituted phenyl-substituted C₁-C₄An alkyl group. In the examples, R³Is unsubstituted aryl-substituted C₁-C₄An alkyl group.

In the examples, R³Is methyl substituted with a substituted or unsubstituted pyridazinyl group. In the examples, R³Is a substituted or unsubstituted pyridazinyl group₁-C₄An alkyl group. In the examples, R³Is a substituted pyridazinyl substituted methyl group. In the examples, R³Is substituted by a substituted pyridazinyl group C₁-C₄An alkyl group. In the examples, R³Is a methyl group substituted with an unsubstituted pyridazinyl group. In the examples, R³Is unsubstituted pyridazinyl substituted C₁-C₄An alkyl group. In the examples, R³Is an unsubstituted ethyl group. In the examples, R³Is unsubstituted C₁-C₄An alkyl group. In the examples, R³Is a pyridyl group substituted with a methoxy group. In the examples, R³Is a substituted pyridyl group. In the examples, R³Is a 5 to 6 membered heteroaryl substituted with methoxy. In the examples, R³Is a substituted 5-to 6-membered heteroaryl. In the examples, R³Is a substituted heteroaryl group.

In the examples, R³Is a methyl group substituted with a piperidinyl group substituted with a substituted or unsubstituted benzyl group. In the examples, R³Is a substituted benzyl-substituted piperidinyl substituentA substituted methyl group. In the examples, R³Is an unsubstituted benzyl-substituted piperidinyl-substituted methyl group. In the examples, R³Is methyl substituted with a substituted piperidinyl group. In the examples, R³Is methyl substituted with a substituted or unsubstituted 5-to 6-membered heterocycloalkyl group. In the examples, R³Is methyl substituted by substituted or unsubstituted heterocycloalkyl. In the examples, R³Is a substituted 5-to 6-membered heterocycloalkyl substituted methyl group. In the examples, R³Is a substituted heterocycloalkyl substituted methyl group. In the examples, R³Is a substituted methyl group. In the examples, R³Is C substituted by a substituted or unsubstituted benzyl-substituted piperidinyl group₁-C₄An alkyl group. In the examples, R³Is substituted with a substituted piperidinyl group₁-C₄An alkyl group. In the examples, R³Is C substituted by substituted or unsubstituted 5-to 6-membered heterocycloalkyl₁-C₄An alkyl group. In the examples, R³Is C substituted by substituted or unsubstituted heterocycloalkyl₁-C₄An alkyl group. In the examples, R³Is a substituted benzyl-substituted piperidinyl-substituted C₁-C₄An alkyl group. In the examples, R³Is unsubstituted piperidinyl-substituted C₁-C₄An alkyl group. In the examples, R³Is substituted with a substituted 5-to 6-membered heterocycloalkyl group₁-C₄An alkyl group. In the examples, R³Is substituted by a substituted heterocycloalkyl group₁-C₄An alkyl group. In the examples, R³Is substituted C₁-C₄An alkyl group. In the examples, R³Is an unsubstituted benzyl-substituted piperidinyl-substituted methyl group. In the examples, R³Is methyl substituted with a substituted piperidinyl group. In the examples, R³Is a substituted 5-to 6-membered heterocycloalkyl substituted methyl group. In the examples, R³Is a substituted heterocycloalkyl substituted methyl group. In the examples, R³Is unsubstituted benzyl-substituted piperidinyl-substituted C₁-C₄An alkyl group. In the examples, R³Is substituted with a substituted piperidinyl group₁-C₄An alkyl group. In the examples, R³Is substituted with a substituted 5-to 6-membered heterocycloalkyl group₁-C₄An alkyl group. In the examples, R³Is substituted by a substituted heterocycloalkyl group₁-C₄An alkyl group.

In the examples, R³Is a 4-membered heteroalkyl group substituted with a substituted or unsubstituted pyridyl group. In the examples, R³Is a 4-membered heteroalkyl group substituted with a substituted or unsubstituted 5-to 6-membered heteroaryl group. In the examples, R³Is a 4-membered heteroalkyl group substituted with a substituted or unsubstituted heteroaryl group. In the examples, R³Is a2 to 6 membered heteroalkyl group substituted with a substituted or unsubstituted pyridyl group. In the examples, R³Is a 2-to 6-membered heteroalkyl substituted with a substituted or unsubstituted 5-to 6-membered heteroaryl. In the examples, R³Is a2 to 6 membered heteroalkyl group substituted with a substituted or unsubstituted heteroaryl group. In the examples, R³Is a 4-membered heteroalkyl group substituted with a substituted pyridyl group. In the examples, R³Is a substituted 5-to 6-membered heteroaryl substituted 4-membered heteroalkyl. In the examples, R³Is a substituted heteroaryl substituted 4-membered heteroalkyl. In the examples, R³Is a2 to 6 membered heteroalkyl substituted with a substituted pyridyl. In the examples, R³Is a 2-to 6-membered heteroalkyl substituted with a substituted 5-to 6-membered heteroaryl. In the examples, R³Is a2 to 6 membered heteroalkyl substituted with a substituted heteroaryl. In the examples, R³Is a 4-membered heteroalkyl group substituted with an unsubstituted pyridyl group. In the examples, R³Is an unsubstituted 5-to 6-membered heteroaryl substituted 4-membered heteroalkyl. In the examples, R³Is an unsubstituted heteroaryl substituted 4 membered heteroalkyl. In the examples, R³Is a2 to 6 membered heteroalkyl substituted with an unsubstituted pyridyl. In the examples, R³Is an unsubstituted 5-to 6-membered heteroaryl substituted 2-to 6-membered heteroalkyl. In the examples, R³Is an unsubstituted heteroaryl substituted 2 to 6 membered heteroalkyl group.

In the examples, R³Is unsubstitutedPyridyl-substituted 4-membered heteroalkyl. In the examples, R³Is an unsubstituted 5-to 6-membered heteroaryl substituted 4-membered heteroalkyl. In the examples, R³Is an unsubstituted heteroaryl substituted 4 membered heteroalkyl. In the examples, R³Is a2 to 6 membered heteroalkyl substituted with an unsubstituted pyridyl. In the examples, R³Is an unsubstituted 5-to 6-membered heteroaryl substituted 2-to 6-membered heteroalkyl. In the examples, R³Is an unsubstituted heteroaryl substituted 2 to 6 membered heteroalkyl group.

In the examples, R³Is ethyl substituted with a substituted or unsubstituted imidazolyl. In the examples, R³Is ethyl substituted with a substituted or unsubstituted 5-to 6-membered heteroaryl. In the examples, R³Is ethyl substituted with substituted or unsubstituted heteroaryl. In the examples, R³Is C substituted by a substituted or unsubstituted imidazolyl group₁-C₄An alkyl group. In the examples, R³Is C substituted with a substituted or unsubstituted 5-to 6-membered heteroaryl group₁-C₄An alkyl group. In the examples, R³Is C substituted by substituted or unsubstituted heteroaryl₁-C₄An alkyl group. In the examples, R³Is ethyl substituted with a substituted imidazolyl group. In the examples, R³Is ethyl substituted with a substituted 5-to 6-membered heteroaryl. In the examples, R³Is ethyl substituted with a substituted heteroaryl group. In the examples, R³Is substituted by a substituted imidazolyl group₁-C₄An alkyl group. In the examples, R³Is substituted with a substituted 5-to 6-membered heteroaryl group₁-C₄An alkyl group. In the examples, R³Is substituted with substituted heteroaryl₁-C₄An alkyl group. In the examples, R³Is an ethyl group substituted with an unsubstituted imidazolyl group. In the examples, R³Is an unsubstituted 5-to 6-membered heteroaryl substituted ethyl group. In the examples, R³Is an unsubstituted heteroaryl substituted ethyl. In the examples, R³Is unsubstituted imidazolyl-substituted C₁-C₄An alkyl group. In the examples, R³Is notSubstituted 5-to 6-membered heteroaryl substituted C₁-C₄An alkyl group. In the examples, R³Is unsubstituted heteroaryl substituted C₁-C₄An alkyl group.

In the examples, R³Is an ethyl group substituted with an unsubstituted imidazolyl group. In the examples, R³Is an unsubstituted 5-to 6-membered heteroaryl substituted ethyl group. In the examples, R³Is an unsubstituted heteroaryl substituted ethyl. In the examples, R³Is unsubstituted imidazolyl-substituted C₁-C₄An alkyl group. In the examples, R³Is unsubstituted 5-to 6-membered heteroaryl substituted C₁-C₄An alkyl group. In the examples, R³Is unsubstituted heteroaryl substituted C₁-C₄An alkyl group.

In the examples, R³Is ethyl substituted by OH. In the examples, R³Is C substituted by OH₁-C₄An alkyl group. In the examples, R³Is a substituted ethyl group. In the examples, R³Is substituted C₁-C₄An alkyl group.

In the examples, R³Is unsubstituted 4-membered heteroalkyl-substituted piperidinyl-substituted methyl. In the examples, R³Is an unsubstituted heteroalkyl-substituted piperidinyl-substituted methyl group. In the examples, R³Is a substituted 5-to 6-membered heterocycloalkyl substituted methyl group. In the examples, R³Is unsubstituted 4-membered heteroalkyl-substituted piperidinyl-substituted C₁-C₄An alkyl group. In the examples, R³Is unsubstituted heteroalkyl-substituted piperidinyl-substituted C₁-C₄An alkyl group. In the examples, R³Is substituted with a substituted 5-to 6-membered heterocycloalkyl group₁-C₄An alkyl group. In the examples, R³Is substituted by a substituted heterocycloalkyl group₁-C₄An alkyl group.

In the examples, R³Is pyrrolidinyl substituted with tert-butoxycarbonyl. In the examples, R³Is a substituted 2-to 8-membered heteroalkyl-substituted pyrrolidineAnd (4) a base. In the examples, R³Is unsubstituted 2-to 8-membered heteroalkyl-substituted pyrrolidinyl. In the examples, R³Is a3 to 6 membered heterocycloalkyl substituted with tert-butoxycarbonyl. In the examples, R³Is a substituted 3-to 6-membered heterocycloalkyl group. In the examples, R³Is a substituted heterocycloalkyl group. In the examples, R³Is unsubstituted 4-membered heteroalkyl. In the examples, R³Is unsubstituted 2-to 6-membered heteroalkyl. In the examples, R³Is unsubstituted heteroalkyl.

In the examples, R³Is unsubstituted cyclobutyl. In the examples, R³Is unsubstituted 3 to 6 membered cycloalkyl. In the examples, R³Is unsubstituted cycloalkyl. In the examples, R³Is unsubstituted pyrrolidinyl. In the examples, R³Is unsubstituted 3-to 6-membered heterocycloalkyl. In the examples, R³Is unsubstituted heterocycloalkyl.

In the examples, R³Is cyclobutyl substituted by OH. In the examples, R³Is a substituted cyclobutyl group. In the examples, R³Is C substituted by OH₃-C₆A cycloalkyl group. In the examples, R³Is substituted C₃-C₆A cycloalkyl group.

In the examples, R³Is propyl substituted by OH. In the examples, R³Is C substituted by OH₁-C₆An alkyl group. In the examples, R³Is a substituted propyl group. In the examples, R³Is substituted C₁-C₆An alkyl group.

In the examples, R³Is azetidinyl substituted with tert-butoxycarbonyl. In the examples, R³Is 2 to 8 membered heteroalkyl substituted azetidinyl substituted with oxo. In the examples, R³Is an azetidinyl substituted with an oxo-substituted heteroalkyl. In the examples, R³Is a substituted 2-to 8-membered heteroalkyl substituted azetidinyl. In the examples, R³Is substituted by substituted heteroalkylAn azetidinyl group.

In the examples, R³Is unsubstituted cyclopentyl. In the examples, R³Is unsubstituted C₃-C₆A cycloalkyl group. In the examples, R³Is unsubstituted cyclopropyl.

In the examples, R³Is methyl substituted by unsubstituted cyclobutyl. In the examples, R³Is unsubstituted C₃-C₆Cycloalkyl-substituted methyl. In the examples, R³Is unsubstituted cyclobutyl substituted C₁-C₄An alkyl group. In the examples, R³Is unsubstituted C₃-C₆Cycloalkyl-substituted C₁-C₄An alkyl group.

In the examples, R³Is unsubstituted oxetanyl. In the examples, R³Is unsubstituted 3-to 6-membered heterocycloalkyl.

In the examples, R³Is unsubstituted isopropyl. In the examples, R³Is unsubstituted propyl. In the examples, R³Is unsubstituted tert-butyl. In the examples, R³Is an unsubstituted butyl group. In the examples, R³Is unsubstituted C₁-C₆An alkyl group.

In the examples, R³Is a 4-membered heteroalkyl substituted with oxo. In the examples, R³Is a2 to 6 membered heteroalkyl substituted with oxo. In the examples, R³Is a substituted 4-membered heteroalkyl group. In the examples, R³Is a substituted 2-to 6-membered heteroalkyl group. In the examples, R³Is a substituted heteroalkyl group.

In the examples, R³Is methyl substituted with unsubstituted tetrahydropyran. In the examples, R³Is methyl substituted with tetrahydropyran. In the examples, R³Is an unsubstituted 5-to 6-membered heterocycloalkyl substituted methyl group. In the examples, R³Is unsubstituted tetrahydropyran substituted C₁-C₄An alkyl group. In the examples, R³Is substituted by tetrahydropyranC of (A)₁-C₄An alkyl group. In the examples, R³Is unsubstituted 5-to 6-membered heterocycloalkyl-substituted C₁-C₄An alkyl group.

In the examples, R³Is by CF₃A substituted methyl group. In the examples, R³Is a quilt C (halogen base)₃A substituted methyl group. In the examples, R³Is by CF₃Substituted C₁-C₄An alkyl group. In the examples, R³Is a quilt C (halogen base)₃Substituted C₁-C₄An alkyl group.

In the examples, R³Is methyl substituted with t-butoxycarbonyl substituted pyrrolidinyl. In the examples, R³Is a pyrrolidinyl substituted methyl substituted with a2 to 8 membered heteroalkyl substituted with oxo. In the examples, R³Is a substituted 2 to 8 membered heteroalkyl substituted pyrrolidinyl substituted methyl. In the examples, R³Is methyl substituted with a3 to 6 membered heterocycloalkyl substituted with tert-butoxycarbonyl. In the examples, R³Is C substituted by tert-butoxycarbonyl-substituted pyrrolidinyl₁-C₄An alkyl group. In the examples, R³Is substituted 2-to 8-membered heteroalkyl-substituted pyrrolidinyl-substituted C₁-C₄An alkyl group. In the examples, R³Is a 3-to 6-membered heterocycloalkyl substituted with a substituted 2-to 8-membered heteroalkyl₁-C₄An alkyl group. In the examples, R³Is substituted with a substituted 3-to 6-membered heterocycloalkyl group₁-C₄An alkyl group.

In the examples, R³Is butyl substituted by OH. In the examples, R³Is a substituted butyl group.

In the examples, R³Is ethyl substituted with OH and unsubstituted pyridyl. In the examples, R³Is ethyl substituted by OH. In the examples, R³Is an ethyl group substituted with an unsubstituted pyridyl group. In the examples, R³Is C substituted by OH and unsubstituted pyridyl₁-C₄An alkyl group. In the examples, R³Is substituted by OHC₁-C₄An alkyl group. In the examples, R³Is unsubstituted pyridyl substituted C₁-C₄An alkyl group. In the examples, R³Is ethyl substituted with OH and unsubstituted 5-to 6-membered heteroaryl. In the examples, R³Is a substituted ethyl group. In the examples, R³Is an unsubstituted 5-to 6-membered heteroaryl substituted ethyl group. In the examples, R³Is C substituted with OH-substituted and unsubstituted 5-to 6-membered heteroaryl₁-C₄An alkyl group. In the examples, R³Is substituted C₁-C₄An alkyl group. In the examples, R³Is unsubstituted 5-to 6-membered heteroaryl substituted C₁-C₄An alkyl group.

In the examples, R³Is methyl substituted with methyl-substituted imidazolyl. In the examples, R³Is methyl substituted with a 5 to 6 membered heteroaryl substituted with methyl. In the examples, R³Is methyl substituted by heteroaryl substituted by methyl. In the examples, R³Is unsubstituted C₁-C₄Alkyl substituted imidazolyl substituted C₁-C₄An alkyl group. In the examples, R³Is unsubstituted C₁-C₄Alkyl substituted 5 to 6 membered heteroaryl substituted C₁-C₄An alkyl group. In the examples, R³Is unsubstituted C₁-C₄Alkyl substituted heteroaryl substituted C₁-C₄An alkyl group.

In the examples, R³Is cyclobutyl substituted by methoxy. In the examples, R³Is cyclobutyl substituted by 2-to 4-membered heteroalkyl. In the examples, R³Is C substituted by methoxy₃-C₆A cycloalkyl group. In the examples, R³Is C substituted by 2-to 4-membered heteroalkyl₃-C₆A cycloalkyl group.

In the examples, R³Is unsubstituted phenyl. In the examples, R³Is unsubstituted aryl.

In the examples, R³Is methyl substituted by imidazolyl. In fact In the examples, R³Is methyl substituted with a 5 to 6 membered heteroaryl. In the examples, R³Is methyl substituted by heteroaryl. In the examples, R³Is methyl substituted with unsubstituted imidazolyl. In the examples, R³Is an unsubstituted 5-to 6-membered heteroaryl substituted methyl. In the examples, R³Is methyl substituted with unsubstituted heteroaryl. In the examples, R³Is C substituted by imidazolyl₁-C₄An alkyl group. In the examples, R³Is C substituted by a 5-to 6-membered heteroaryl group₁-C₄An alkyl group. In the examples, R³Is C substituted by heteroaryl₁-C₄An alkyl group. In the examples, R³Is unsubstituted imidazolyl-substituted C₁-C₄An alkyl group. In the examples, R³Is unsubstituted 5-to 6-membered heteroaryl substituted C₁-C₄An alkyl group. In the examples, R³Is unsubstituted heteroaryl substituted C₁-C₄An alkyl group.

In the examples, R³Is cyclopentyl substituted by OH. In the examples, R³Is C substituted by OH₃-C₆A cycloalkyl group. In the examples, R³Is a substituted cyclopentyl group. In the examples, R³Is substituted C₃-C₆A cycloalkyl group.

In the examples, R³Is ethyl substituted by OH-substituted phenyl. In the examples, R³Is ethyl substituted with an OH substituted aryl. In the examples, R³Is a substituted aryl substituted ethyl group. In the examples, R³Is C substituted by OH-substituted phenyl₁-C₄An alkyl group. In the examples, R³Is C substituted by OH-substituted aryl₁-C₄An alkyl group. In the examples, R³Is substituted by substituted aryl₁-C₄An alkyl group.

In the examples, R³Is ethyl substituted with t-butoxycarbonyl substituted tetrahydropyran. In the examples, R³Is a substituted 2-to 8-membered heteroalkyl-substituted tetrahydropyranA substituted ethyl group. In the examples, R³Is ethyl substituted with a 3 to 6 membered heterocycloalkyl substituted with tert-butoxycarbonyl. In the examples, R³Is C substituted by tetrahydropyran substituted by tert-butoxycarbonyl₁-C₄An alkyl group.

In the examples, R³Is an unsubstituted pyrrolidinyl-substituted ethyl group. In the examples, R³Is an unsubstituted 3-to 6-membered heterocycloalkyl substituted ethyl group. In the examples, R³Is unsubstituted pyrrolidinyl substituted C₁-C₄An alkyl group. In the examples, R³Is unsubstituted 5-to 6-membered heterocycloalkyl-substituted C₁-C₄An alkyl group.

In the examples, R³Is ethyl substituted with t-butoxycarbonyl substituted pyrrolidinyl. In the examples, R³Is a substituted 2 to 8 membered heteroalkyl substituted pyrrolidinyl substituted ethyl. In the examples, R³Is ethyl substituted with a 3 to 6 membered heterocycloalkyl substituted with tert-butoxycarbonyl.

In the examples, R³Is C substituted by tert-butoxycarbonyl-substituted pyrrolidinyl₁-C₄An alkyl group. In the examples, R³Is substituted 2-to 8-membered heteroalkyl-substituted pyrrolidinyl-substituted C₁-C₄An alkyl group. In the examples, R³Is C substituted by a 3-to 6-membered heterocycloalkyl group substituted by a tert-butoxycarbonyl group₁-C₄An alkyl group.

In the examples, R³Is methyl substituted by unsubstituted pyrrolidinyl. In the examples, R³Is an unsubstituted 3-to 6-membered heterocycloalkyl substituted methyl group.

In the examples, R³Is unsubstituted pyrrolidinyl substituted C₁-C₄An alkyl group. In the examples, R³Is unsubstituted 3-to 6-membered heterocycloalkyl-substituted C₁-C₄An alkyl group.

In the examples, R³Is ethyl substituted with unsubstituted morpholinyl. In the examples, R³Is unsubstituted morpholinyl substitutedAnd (4) ethyl. In the examples, R³Is an unsubstituted 5-to 6-membered heterocycloalkyl substituted ethyl group. In the examples, R³Is unsubstituted morpholinyl substituted C₁-C₄An alkyl group.

In the examples, R³Is ethyl substituted by OH-substituted phenyl. In the examples, R³Is ethyl substituted with an OH substituted aryl. In the examples, R³Is substituted by substituted phenyl₁-C₄An alkyl group. In the examples, R³Is substituted by substituted aryl₁-C₄An alkyl group.

In the examples, R³Is unsubstituted piperidinyl substituted methyl. In the examples, R³Is an unsubstituted 5-to 6-membered heterocycloalkyl substituted methyl group. In the examples, R³Is an unsubstituted heterocycloalkyl substituted methyl group. In the examples, R³Is unsubstituted piperidinyl-substituted C₁-C₄An alkyl group. In the examples, R³Is unsubstituted 5-to 6-membered heterocycloalkyl-substituted C₁-C₄An alkyl group. In the examples, R³Is unsubstituted heterocycloalkyl-substituted C₁-C₄An alkyl group.

In the examples, R³Is an ethyl group substituted with an OH-substituted methyl-substituted phenyl group. In the examples, R³Is an ethyl group substituted with an aryl group substituted with an OH-substituted methyl group. In the examples, R³Is a substituted phenyl substituted ethyl group. In the examples, R³Is a substituted aryl substituted ethyl group. In the examples, R³Is substituted by substituted phenyl₁-C₄An alkyl group. In the examples, R³Is substituted by substituted aryl₁-C₄An alkyl group.

In the examples, R³Is ethyl substituted with Cl substituted phenyl. In the examples, R³Is an ethyl group substituted with an aryl group substituted with a halogen group. In the examples, R³Is ethyl substituted with phenyl substituted with halo. In the examples, R³Is C substituted by Cl-substituted phenyl₁-C₄An alkyl group. In the examples, R³Is C substituted by phenyl substituted by halogen₁-C₄An alkyl group. In the examples, R³Is aryl substituted by halogen₁-C₄An alkyl group.

In the examples, R³Is methyl substituted with unsubstituted tetrahydrofuranyl. In the examples, R³Is methyl substituted by tetrahydrofuranyl. In the examples, R³Is an unsubstituted 3-to 6-membered heterocycloalkyl substituted methyl group. In the examples, R³Is unsubstituted tetrahydrofuranyl-substituted C₁-C₄An alkyl group. In the examples, R³Is C substituted by tetrahydrofuranyl₁-C₄An alkyl group.

In the examples, R³Is an ethyl group substituted with an unsubstituted phenyl group. In the examples, R³Is an unsubstituted aryl substituted ethyl group. In the examples, R³Is unsubstituted phenyl-substituted C₁-C₄An alkyl group. In the examples, R³Is unsubstituted aryl-substituted C₁-C₄An alkyl group.

In the examples, R³Is unsubstituted azetidinyl. In the examples, R³Is unsubstituted 3-to 6-membered heterocycloalkyl

In the examples, R³Is methyl substituted by phenoxy substituted by methoxy. In the examples, R³Is methyl substituted with 2 to 4-membered alkoxy substituted phenoxy substituted pyridyl. In the examples, R³Is methyl substituted with 2 to 4-membered alkoxy-substituted aryloxy-substituted pyridyl. In the examples, R³Is methyl substituted with 5 to 6 membered heteroaryl substituted with 2 to 4 membered alkoxy substituted aryloxy. In the examples, R³Is C substituted with a 5-to 6-membered heteroaryl group substituted with a 2-to 4-membered alkoxy-substituted aryloxy group₁-C₄An alkyl group.

In the examples, R³Is ethyl substituted with methoxy substituted pyridyl. In the examples, R³Is 2 to 4 yuanAlkoxy substituted pyridyl substituted ethyl. In the examples, R³Is ethyl substituted with a 5 to 6 membered heteroaryl substituted with a 2 to 4 membered alkoxy. In the examples, R³Is C substituted with a 5-to 6-membered heteroaryl group substituted with a 2-to 4-membered alkoxy group₁-C₄An alkyl group. In the examples, R³Is C substituted by 2-to 4-membered alkoxy-substituted heteroaryl₁-C₄An alkyl group.

In the examples, R³Is ethyl substituted by methoxy substituted phenyl. In the examples, R³Is ethyl substituted with phenyl substituted with 2 to 4 membered alkoxy. In the examples, R³Is ethyl substituted with 2 to 4 membered alkoxy substituted aryl. In the examples, R³Is C substituted by aryl substituted by 2-to 4-membered alkoxy₁-C₄An alkyl group.

In the examples, R³Is ethyl substituted with phenyl substituted with a 2 to 4 membered heteroalkyl substituted with oxo. In the examples, R³Is a substituted 2 to 4 membered heteroalkyl substituted phenyl substituted ethyl. In the examples, R³Is ethyl substituted with 2 to 4 membered heteroalkyl substituted aryl. In the examples, R³Is substituted 2-to 4-membered heteroalkyl-substituted aryl-substituted C₁-C₄An alkyl group.

In the examples, R³Is propyl substituted with methoxy substituted phenyl. In the examples, R³Is a propyl group substituted with a phenyl group substituted with a 2 to 4-membered alkoxy group. In the examples, R³Is a propyl group substituted with a 2 to 4-membered alkoxy-substituted aryl group. In the examples, R³Is C substituted by aryl substituted by 2-to 4-membered alkoxy₁-C₄An alkyl group.

In the examples, R³Is ethyl substituted with phenyl substituted with a 2 to 4 membered heteroalkyl substituted with oxo. In the examples, R³Is a substituted 2 to 4 membered heteroalkyl substituted phenyl substituted ethyl. In the examples, R³Is ethyl substituted with 2 to 4 membered heteroalkyl substituted aryl. In the examples, R³Is substituted with substituted 2-to 4-membered heteroalkyl-substituted arylC₁-C₄An alkyl group.

In the examples, R³Is an ethyl group substituted with an unsubstituted cyclopentyl group. In the examples, R³Is unsubstituted C₃-C₆Cycloalkyl-substituted ethyl. In the examples, R³Is unsubstituted C₃-C₆Cycloalkyl-substituted C₁-C₄An alkyl group.

In the examples, R³Is ethyl substituted with t-butoxycarbonyl substituted pyrrolidinyl. In the examples, R³Is a pyrrolidinyl substituted ethyl substituted with oxo substituted 4 to 8 membered heteroalkyl substituted. In the examples, R³Is a substituted 4 to 8 membered heteroalkyl substituted pyrrolidinyl substituted ethyl. In the examples, R³Is a 3 to 6 membered heterocycloalkyl substituted ethyl substituted with a substituted 4 to 8 membered heteroalkyl. In the examples, R³Is a 3-to 6-membered heterocycloalkyl substituted with a substituted 4-to 8-membered heteroalkyl₁-C₄An alkyl group.

In the examples, R³Is ethyl substituted with t-butoxycarbonyl substituted azetidinyl. In the examples, R³Is an ethyl group substituted with an oxo-substituted 4 to 8 membered heteroalkyl-substituted azetidinyl group. In the examples, R³Is a substituted 4 to 8 membered heteroalkyl substituted azetidinyl substituted ethyl. In the examples, R³Is a substituted 4-to 8-membered heteroalkyl-substituted azetidinyl-substituted C₁-C₄An alkyl group.

In the examples, R³Is an ethyl group substituted with an unsubstituted azetidinyl group. In the examples, R³Is unsubstituted C₃-C₆Heterocycloalkyl substituted ethyl. In the examples, R³Is unsubstituted C₃-C₆Heterocycloalkyl-substituted C₁-C₄An alkyl group.

In the examples, R³Is ethyl substituted with phenyl substituted with CN. In the examples, R³Is a substituted phenyl substituted ethyl group. In the examples, R³Is substituted by CNAryl-substituted ethyl group of (1). In the examples, R³Is aryl substituted by CN₁-C₄An alkyl group. In the examples, R³Is substituted by substituted aryl₁-C₄An alkyl group.

In the examples, R³Is an unsubstituted phenyl-substituted ethyl-substituted piperidinyl-substituted methyl group. In the examples, R³Is an unsubstituted aryl-substituted ethyl-substituted piperidinyl-substituted methyl group. In the examples, R³Is unsubstituted aryl-substituted C₁-C₄Alkyl-substituted piperidinyl-substituted methyl. In the examples, R³Is unsubstituted aryl-substituted C₁-C₄Alkyl-substituted 3 to 6 membered heterocycloalkyl-substituted methyl. In the examples, R³Is unsubstituted aryl-substituted C₁-C₄Alkyl substituted 3 to 6 membered heterocycloalkyl substituted C₁-C₄An alkyl group.

In the examples, R³Is methyl substituted by methoxy substituted pyridyl. In the examples, R³Is methyl substituted with substituted or unsubstituted 2-to 4-membered alkoxy substituted pyridyl. In the examples, R³Is methyl substituted with a substituted or unsubstituted 2-to 4-membered alkoxy substituted 5-to 6-membered heteroaryl. In the examples, R³Is C substituted with a substituted or unsubstituted 2-to 4-membered alkoxy-substituted 5-to 6-membered heteroaryl group₁-C₄An alkyl group. In the examples, R³Is methyl substituted with substituted 2-to 4-membered alkoxy substituted pyridyl. In the examples, R³Is a substituted 2-to 4-membered alkoxy substituted 5-to 6-membered heteroaryl substituted methyl. In the examples, R³Is a substituted 2-to 4-membered alkoxy-substituted 5-to 6-membered heteroaryl-substituted C₁-C₄An alkyl group. In the examples, R³Is methyl substituted by unsubstituted 2-to 4-membered alkoxy-substituted pyridyl. In the examples, R³Is an unsubstituted 2-to 4-membered alkoxy-substituted 5-to 6-membered heteroaryl-substituted methyl group. In the examples, R³Is unsubstituted 2-to 4-membered alkoxy-substituted5-to 6-membered heteroaryl substituted C₁-C₄An alkyl group.

In the examples, R³Is methyl substituted by unsubstituted 2-to 4-membered alkoxy-substituted pyridyl. In the examples, R³Is an unsubstituted 2-to 4-membered alkoxy-substituted 5-to 6-membered heteroaryl-substituted methyl group. In the examples, R³Is unsubstituted 2-to 4-membered alkoxy-substituted 5-to 6-membered heteroaryl-substituted C₁-C₄An alkyl group.

In the examples, R³Is methyl substituted by unsubstituted pyridyl. In the examples, R³Is an unsubstituted 5-to 6-membered heteroaryl substituted methyl. In the examples, R³Is unsubstituted 5-to 6-membered heteroaryl substituted C₁-C₄An alkyl group.

In the examples, R³Is ethyl substituted by phenyl substituted by carboxyl. In the examples, R³Is a substituted phenyl substituted ethyl group. In the examples, R³Is ethyl substituted with aryl substituted with carboxyl. In the examples, R³Is aryl substituted by carboxyl₁-C₄An alkyl group.

In the examples, R³Is by SO₂NH₂Substituted phenyl substituted ethyl. In the examples, R³Is by SO₂NH₂Substituted aryl substituted ethyl. In the examples, R³Is by SO₂NH₂Substituted aryl substituted C₁-C₄An alkyl group.

In the examples, R³Is hydrogen. In the examples, R³Is ethyl substituted with phenyl substituted with tert-butyl carbamate. In the examples, R³Is an ethyl group substituted with a phenyl group substituted with a 6 to 8 membered heteroalkyl group substituted with an oxo group. In the examples, R³Is a substituted 6 to 8 membered heteroalkyl substituted phenyl substituted ethyl. In the examples, R³Is a substituted 6 to 8 membered heteroalkyl substituted aryl substituted ethyl. In the examples, R³Is substituted 6-to 8-membered heteroalkyl-substituted aryl-substituted C₁-C₄An alkyl group.

In the examples, R³Is ethyl substituted with tert-butoxycarbonyl substituted piperidinyl. In the examples, R³Is a piperidinyl-substituted ethyl substituted with a 5 to 7 membered heteroalkyl substituted with oxo. In the examples, R³Is a substituted 5 to 7 membered heteroalkyl substituted piperidinyl substituted ethyl. In the examples, R³Is a 5 to 6 membered heterocycloalkyl substituted ethyl substituted with a substituted 5 to 7 membered heteroalkyl. In the examples, R³Is a 5-to 6-membered heterocycloalkyl substituted with a substituted 5-to 7-membered heteroalkyl₁-C₄An alkyl group.

In the examples, R³Is methyl substituted by unsubstituted thiazolyl. In the examples, R³Is an unsubstituted 5-to 6-membered heteroaryl substituted methyl. In the examples, R³Is unsubstituted 5-to 6-membered heteroaryl substituted C₁-C₄An alkyl group.

In the examples, R³Is by NH₂Substituted phenyl substituted ethyl. In the examples, R³Is by NH₂Substituted aryl substituted ethyl. In the examples, R³Is by NH₂Substituted aryl substituted C₁-C₄An alkyl group. In the examples, R³Is substituted by substituted aryl₁-C₄An alkyl group.

In the examples, R³Is an unsubstituted piperidinyl-substituted ethyl group. In the examples, R³Is an unsubstituted 5-to 6-membered heterocycloalkyl substituted ethyl group. In the examples, R³Is unsubstituted 5-to 6-membered heterocycloalkyl-substituted C₁-C₄An alkyl group.

In the examples, R³Is ethyl substituted with phenyl substituted with a 2 to 6 membered heteroalkyl substituted with oxo. In the examples, R³Is a substituted 2 to 6 membered heteroalkyl substituted phenyl substituted ethyl. In the examples, R³Is a substituted 2 to 6 membered heteroalkyl substituted aryl substituted ethyl. In the examples, R³Is substituted 2-to 6-membered heteroalkyl-substituted aryl-substituted C₁-C₄An alkyl group.

In the examples, R³Is thatIn the examples, R³Is thatIn the examples, R³Is thatIn the examples, R³Is that

In the examples, R³Is that

In the examples, R³Is thatIn the examples, R³Is thatIn the examples, R³Is that

In the examples, R³Is thatIn the examples, R³Is thatIn the examples, R³Is thatIn the examples, R³Is thatIn the examples, R³Is thatIn the examples, R³Is that

In the examples, R³Is that

In the examples, R³Is thatIn the examples, R³Is thatIn the examples, R³Is that

In the examples, R³Is that

In the examples, R³Is thatIn the examples, R³Is that

In the examples, R³Is that

In the examples, R³Is thatIn the examples, R³Is that

In the examples, R³Is thatIn the examples, R³Is thatIn the examples, R³Is thatIn the examples, R³Is thatIn the examples, R³Is that

In the examples, R³Is that

In the examples, R³Is thatIn the examples, R³Is that

In the examples, R³Is that

In the examples, R³Is thatIn the examples, R³Is thatIn the examples, R³Is thatIn the examples, R³Is that

In the examples, R³Is thatIn the examples, R³Is that

In the examples, R³Is that

In the examples, R³Is thatIn the examples, R³Is that

In the examples, R³Is that

In the examples, R³Is thatIn the examples, R³Is thatIn the examples, R³Is thatIn the examples, R³Is that

In the examples, R³Is that

In the examples, R³Is thatIn the examples, R³Is that

In the examples, R³Is that

In the examples, R³Is thatIn the examples, R³Is thatIn the examples, R³Is thatIn the examples, R³Is that

In the examples, R³Is thatIn the examples, R³Is that

In the examples, R³Is thatIn the examples, R³Is thatIn the examples, R³Is that

In the examples, R³Is thatIn the examples, R³Is that

In the examples, R³Is that

In the examples, R³Is thatIn the examples, R³Is thatIn the examples, R³Is thatIn the examples, R³Is thatIn the examples, R³Is that

In the examples, R³Is thatIn the examples, R³Is thatIn the examples, R³Is that

In the examples, R³Is thatIn the examples, R³Is that

In the examples, R³Is that

In the examples, R³Is thatIn the examples, R³Is that

In the examples, R³Is thatIn the examples, R³Is thatIn the examples, R³Is that

In the examples, R³Is that

In the examples, R³Is thatIn the examples, R³Is thatIn the examples, R³Is thatIn the examples, R³Is that

In the examples, R³Is thatIn the examples, R³Is thatIn the examplesIn, R³Is that

In the examples, R³Is that

In the examples, R³Is thatIn the examples, R³Is that

In the examples, R³Is thatIn the examples, R³Is thatIn the examples, R³Is that

In the examples, R³Is thatIn the examples, R³Is that

In the examples, R³Is thatIn the examples, R³Is thatIn the examples, R³Is thatIn the examples, R³Is that

In the examples, R³Is thatIn the examples, R³Is that

In the examples, R³Is that

In the examples, R³Is thatIn the examples, R³Is that

In the examples, R³Is thatIn the examples, R³Is thatIn the examples, R³Is that

In the examples, R³Is that

In the examples, R⁴Is hydrogen, substituted or unsubstituted C₁-C₆Alkyl, substituted or unsubstituted 2-to 6-membered heteroalkyl, substituted or unsubstituted C₃-C₆Cycloalkyl, substituted or unsubstituted 3-to 6-membered heterocycloalkyl, substituted or unsubstituted phenyl, or substituted or unsubstituted 5-to 6-membered heteroaryl.

In the examples, R⁴Independently halogen, -CCl₃、-CBr₃、-CF₃、-CI₃、CHCl₂、-CHBr₂、-CHF₂、-CHI₂、-CH₂Cl、-CH₂Br、-CH₂F、-CH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂、-NHC(O)NH₂、-NHSO₂H、-NHC(O)H、-NHC(O)OH、-NHOH、-OCCl₃、-OCF₃、-OCBr₃、-OCI₃、-OCHCl₂、-OCHBr₂、-OCHI₂、-OCHF₂、-OCH₂Cl、-OCH₂Br、-OCH₂I、-OCH₂F、-N₃Quilt R²⁹Substituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl) or by R²⁹Substituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl).

In the examples, R⁴Is by R²⁹Substituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R⁴Is by R²⁹Substituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R⁴Is unsubstituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R⁴Is by R²⁹Substituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R⁴Is by R²⁹Substituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R⁴Is unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl).

In the examples, R^4A、R^4B、R^4CAnd R^4DIndependently hydrogen, halogen, -CF₃、-CBr₃、-CCl₃、-CI₃、-CHF₂、-CHBr₂、-CHCl₂、-CHI₂、-CH₂F、-CH₂Br、-CH₂Cl、-CH₂I、-OCF₃、-OCBr₃、-OCCl₃、-OCI₃、-OCHF₂、-OCHBr₂、-OCHCl₂、-OCHI₂、-OCH₂F、-OCH₂Br、-OCH₂Cl、-OCH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂Quilt R²⁹Substituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl), by R²⁹Substituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl),

By R²⁹Substituted or unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl), by R²⁹Substituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl), with R²⁹Substituted or unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl) or by R²⁹Substituted or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl).

In the examples, R^4A、R^4B、R^4CAnd R^4DIndependently is by R²⁹Substituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^4A、R^4B、R^4CAnd R^4DIndependently is by R²⁹Substituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^4A、R^4B、R^4CAnd R^4DIndependently is unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^4A、R^4B、R^4CAnd R^4DIndependently is by R²⁹Substituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R^4A、R^4B、R^4CAnd R^4DIndependently is by R²⁹Substituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R^4A、R^4B、R^4CAnd R^4DIndependently an unsubstituted heteroalkyl group (e.g., a 2-to 8-membered heteroalkyl group, a 2-to 6-membered heteroalkyl group, or a 2-to 4-membered heteroalkyl group). In the examples, R^4A、R^4B、R^4CAnd R^4DIndependently is by R²⁹Substituted or unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups). In the examples, R^4A、R^4B、R^4CAnd R^4DIndependently is by R²⁹Substituted cycloalkyl (e.g. C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups). In the examples, R^4A、R^4B、R^4CAnd R^4DIndependently is unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups). In the examples, R^4A、R^4B、R^4CAnd R^4DIndependently is by R²⁹Substituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl). In the examples, R^4A、R^4B、R^4CAnd R^4DIndependently is by R²⁹Substituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl). In the examples, R^4A、R^4B、R^4CAnd R^4DIndependently an unsubstituted heterocycloalkyl group (e.g., a 3-to 8-membered heterocycloalkyl group, a 3-to 6-membered heterocycloalkyl group, or a 5-to 6-membered heterocycloalkyl group). In the examples, R^4A、R^4B、R^4CAnd R^4DIndependently is by R²⁹Substituted or unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl). In the examples, R^4A、R^4B、R^4CAnd R^4DIndependently is by R²⁹Substituted aryl radicals (e.g. C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl). In the examples, R^4A、R^4B、R^4CAnd R^4DIndependently is unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl). In the examples, R^4A、R^4B、R^4CAnd R^4DIndependently is by R²⁹Substituted or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl). In the examples, R^4A、R^4B、R^4CAnd R^4DIndependently is by R²⁹Substituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl). In the examples, R^4A、R^4B、R^4CAnd R^4DIndependently unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl).

R²⁹Independently oxo, halogen, -CCl₃、-CBr₃、-CF₃、-CI₃、CHCl₂、-CHBr₂、-CHF₂、-CHI₂、-CH₂Cl、-CH₂Br、-CH₂F、-CH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂、-NHC(O)NH₂、-NHSO₂H、-NHC(O)H、-NHC(O)OH、-NHOH、-OCCl₃、-OCF₃、-OCBr₃、-OCI₃、-OCHCl₂、-OCHBr₂、-OCHI₂、-OCHF₂、-OCH₂Cl、-OCH₂Br、-OCH₂I、-OCH₂F、-N₃Quilt R³⁰Substituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl), by R³⁰Substituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl), with R³⁰Substituted or unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl), by R³⁰Substituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl), with R³⁰Substituted or unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl) or by R³⁰Substituted or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered)Heteroaryl or 5-to 6-membered heteroaryl).

R³⁰Independently oxo, halogen, -CCl₃、-CBr₃、-CF₃、-CI₃、CHCl₂、-CHBr₂、-CHF₂、-CHI₂、-CH₂Cl、-CH₂Br、-CH₂F、-CH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂、-NHC(O)NH₂、-NHSO₂H、-NHC(O)H、-NHC(O)OH、-NHOH、-OCCl₃、-OCF₃、-OCBr₃、-OCI₃、-OCHCl₂、-OCHBr₂、-OCHI₂、-OCHF₂、-OCH₂Cl、-OCH₂Br、-OCH₂I、-OCH₂F、-N₃Quilt R³¹Substituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl), by R³¹Substituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl), with R³¹Substituted or unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl), by R³¹Substituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl), with R³¹Substituted or unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl) or by R³¹Substituted or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl).

In the examples, R⁴Is by R²⁹Substituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R⁴Is by R²⁹Substituted alkyl radical(e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R⁴Is unsubstituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R⁴Is by R²⁹Substituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R⁴Is by R²⁹Substituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R⁴Is unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R⁴Is hydrogen, halogen, -CX⁴ ₃、-CHX⁴ ₂、-CH₂X⁴、-OCX⁴ ₃、-OCH₂X⁴、-OCHX⁴ ₂、-CN、-SR^4D、-NR^4AR^4BOr substituted or unsubstituted C₁-C₆An alkyl group. In the examples, R⁴Is hydrogen, halogen, -CX₃、-NR^4AR^4BOr substituted or unsubstituted C₁-C₆An alkyl group. In the examples, R⁴Is hydrogen, halogen, -CF₃、-NH₂、-NH(CH₃) Or unsubstituted C₁-C₆An alkyl group. In the examples, R⁴Is hydrogen or unsubstituted methyl.

In the examples, R⁴Is hydrogen. In the examples, R⁴is-NH (CH)₃). In the examples, R⁴Is unsubstituted 2-to 3-membered heteroalkyl. In the examples, R⁴Is a 2 to 3 membered heteroalkyl group. In the examples, R⁴is-NH₂. In the examples, R⁴is-NH (R)^4A). In the examples, R⁴is-NR^4AR^4B。

In the examples, R^4AIs by R²⁹Substituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical、C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^4AIs by R²⁹Substituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^4AIs unsubstituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^4AIs unsubstituted C₁-C₄An alkyl group. In the examples, R^4AIs unsubstituted C₁-C₂An alkyl group. In the examples, R^4AIs hydrogen.

In the examples, R^4BIs by R²⁹Substituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^4BIs by R²⁹Substituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^4BIs unsubstituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^4BIs unsubstituted C₁-C₄An alkyl group. In the examples, R^4BIs unsubstituted C₁-C₂An alkyl group. In the examples, R^4BIs hydrogen.

In the examples, R^4CIs by R²⁹Substituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^4CIs by R²⁹Substituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^4CIs unsubstituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^4CIs unsubstituted C₁-C₄An alkyl group. In the examples, R^4CIs unsubstituted C₁-C₂An alkyl group. In the examples, R^4CIs hydrogen.

In the examples, R^4DIs by R²⁹Substituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^4DIs by R²⁹Substituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^4DIs unsubstituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^4DIs unsubstituted C₁-C₄An alkyl group. In the examples, R^4DIs unsubstituted C₁-C₂An alkyl group. In the examples, R^4DIs hydrogen.

In the examples, R⁴Is unsubstituted methyl. In the examples, R⁴Is unsubstituted C₁-C₃An alkyl group. In the examples, R⁴Is an unsubstituted ethyl group.

In the examples, R⁴is-CF₃. In the examples, R⁴is-CHF₂. In the examples, R⁴is-CH₂F. In the examples, R⁴is-CX⁴ ₃. In the examples, R⁴is-CHX⁴ ₂. In the examples, R⁴is-CH₂X⁴。X⁴Independently is-F, -Cl, -Br or-I.

In the examples, R⁵Is hydrogen, substituted or unsubstituted C₁-C₆Alkyl, substituted or unsubstituted 2-to 6-membered heteroalkyl, substituted or unsubstituted C₃-C₆Cycloalkyl, substituted or unsubstituted 3-to 6-membered heterocycloalkyl, substituted or unsubstituted phenyl orSubstituted or unsubstituted 5-to 6-membered heteroaryl.

In the examples, R⁵Independently halogen, -CCl₃、-CBr₃、-CF₃、-CI₃、CHCl₂、-CHBr₂、-CHF₂、-CHI₂、-CH₂Cl、-CH₂Br、-CH₂F、-CH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂、-NHC(O)NH₂、-NHSO₂H、-NHC(O)H、-NHC(O)OH、-NHOH、-OCCl₃、-OCF₃、-OCBr₃、-OCI₃、-OCHCl₂、-OCHBr₂、-OCHI₂、-OCHF₂、-OCH₂Cl、-OCH₂Br、-OCH₂I、-OCH₂F、-N₃Quilt R³²Substituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl) or by R³²Substituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl).

In the examples, R⁵Is by R³²Substituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R⁵Is by R³²Substituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R⁵Is unsubstituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R⁵Is by R³²Substituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R⁵Is by R³²Substituted heteroalkyl groups (e.g., 2-to 8-membered heteroalkyl groups,2 to 6 membered heteroalkyl or 2 to 4 membered heteroalkyl). In the examples, R⁵Is unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl).

In the examples, R^5A、R^5B、R^5CAnd R^5DIndependently of each other is hydrogen, halogen, CF₃、-CBr₃、-CCl₃、-CI₃、-CHF₂、-CHBr₂、-CHCl₂、-CHI₂、-CH₂F、-CH₂Br、-CH₂Cl、-CH₂I、-OCF₃、-OCBr₃、-OCCl₃、-OCI₃、-OCHF₂、-OCHBr₂、-OCHCl₂、-OCHI₂、-OCH₂F、-OCH₂Br、-OCH₂Cl、-OCH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂Quilt R³²Substituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl), by R³²Substituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl), with R³²Substituted or unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl), by R³²Substituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl), with R³²Substituted or unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl) or by R³²Substituted or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl).

In the examples, R^5A、R^5B、R^5CAnd R^5DIndependently is by R³²Substituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^5A、R^5B、R^5CAnd R^5DIndependently is by R³²Substituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^5A、R^5B、R^5CAnd R^5DIndependently is unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^5A、R^5B、R^5CAnd R^5DIndependently is by R³²Substituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R^5A、R^5B、R^5CAnd R^5DIndependently is by R³²Substituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R^5A、R^5B、R^5CAnd R^5DIndependently an unsubstituted heteroalkyl group (e.g., a 2-to 8-membered heteroalkyl group, a 2-to 6-membered heteroalkyl group, or a 2-to 4-membered heteroalkyl group). In the examples, R^5A、R^5B、R^5CAnd R^5DIndependently is by R³²Substituted or unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups). In the examples, R^5A、R^5B、R^5CAnd R^5DIndependently is by R³²Substituted cycloalkyl (e.g. C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups). In the examples, R^5A、R^5B、R^5CAnd R^5DIndependently is unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups). In the examples, R^5A、R^5B、R^5CAnd R^5DIndependently is by R³²Substituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl). In the examples, R^5A、R^5B、R^5CAnd R^5DIndependently is by R³²Substituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl). In the examples, R^5A、R^5B、R^5CAnd R^5DIndependently an unsubstituted heterocycloalkyl group (e.g., a 3-to 8-membered heterocycloalkyl group, a 3-to 6-membered heterocycloalkyl group, or a 5-to 6-membered heterocycloalkyl group). In the examples, R^5A、R^5B、R^5CAnd R^5DIndependently is by R³²Substituted or unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl). In the examples, R^5A、R^5B、R^5CAnd R^5DIndependently is by R³²Substituted aryl radicals (e.g. C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl). In the examples, R^5A、R^5B、R^5CAnd R^5DIndependently is unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl). In the examples, R^5A、R^5B、R^5CAnd R^5DIndependently is by R³²Substituted or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl). In the examples, R^5A、R^5B、R^5CAnd R^5DIndependently is by R³²Substituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl). In the examples, R^5A、R^5B、R^5CAnd R^5DIndependently unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl).

R³²Independently oxo, halogen, -CCl₃、-CBr₃、-CF₃、-CI₃、CHCl₂、-CHBr₂、-CHF₂、-CHI₂、-CH₂Cl、-CH₂Br、-CH₂F、-CH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂、-NHC(O)NH₂、-NHSO₂H、-NHC(O)H、-NHC(O)OH、-NHOH、-OCCl₃、-OCF₃、-OCBr₃、-OCI₃、-OCHCl₂、-OCHBr₂、-OCHI₂、-OCHF₂、-OCH₂Cl、-OCH₂Br、-OCH₂I、-OCH₂F、-N₃Quilt R³³Substituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl), by R³³Substituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl), with R³³Substituted or unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl), by R³³Substituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl), with R³³Substituted or unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl) or by R³³Substituted or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl).

R³³Independently oxo, halogen, -CCl₃、-CBr₃、-CF₃、-CI₃、CHCl₂、-CHBr₂、-CHF₂、-CHI₂、-CH₂Cl、-CH₂Br、-CH₂F、-CH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂、-NHC(O)NH₂、-NHSO₂H、-NHC(O)H、-NHC(O)OH、-NHOH、-OCCl₃、-OCF₃、-OCBr₃、-OCI₃、-OCHCl₂、-OCHBr₂、-OCHI₂、-OCHF₂、-OCH₂Cl、-OCH₂Br、-OCH₂I、-OCH₂F、-N₃Quilt R³⁴Substituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl), by R³⁴Substituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl), with R³⁴Substituted or unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl), by R³⁴Substituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl), with R³⁴Substituted or unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl) or by R³⁴Substituted or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl).

In the examples, R⁵Is hydrogen, halogen, -CX⁵ ₃、-CHX⁵ ₂、-CH₂X⁵、-OCX⁵ ₃、-OCH₂X⁵、-OCHX⁵ ₂、-CN、-SR^5D、-NR^5AR^5BOr substituted or unsubstituted C₁-C₆An alkyl group. In the examples, R⁵Is hydrogen, halogen, -CX⁵ ₃、-NR^5AR^5BOr substituted or unsubstituted C₁-C₆An alkyl group. In the examples, R⁵Is hydrogen, halogen, -CF₃、-NH₂、-NH(CH₃) Or unsubstituted C₁-C₆An alkyl group. In the examples, R⁵Is hydrogen or unsubstituted methyl. In the examples, R⁵Is unsubstituted methyl. In the examples, R⁵Is unsubstituted C₁-C₃An alkyl group. In the examples, R⁵Is an unsubstituted ethyl group. In the examples, R⁵Is unsubstituted methyl.

In the examples, R⁵Is by R³²Substituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R⁵Is by R³²Substituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R⁵Is unsubstituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R⁵Is by R³²Substituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R⁵Is by R³²Substituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R⁵Is unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R⁵Is unsubstituted methyl. In the examples, R⁵Is unsubstituted C₁-C₂An alkyl group. In the examples, R⁵Is unsubstituted C₁-C₃An alkyl group. In the examples, R⁵Is hydrogen.

In the examples, R⁶Is a halogen. In the examples, R⁶is-CX⁶ ₃. In the examples, R⁶is-CHX⁶ ₂. In the examples, R⁶is-CH₂X⁶. In the examples, R⁶is-OCX⁶ ₃. In the examples, R⁶is-OCH₂X⁶. In the examples, R⁶is-OCHX⁶ ₂. In the examples, R⁶is-CN. In the examples, R⁶is-SR^6D. In the examples, R⁶is-SO₂R^6D. In the examples, R⁶is-NR^6AR^6B. In the examples, R⁶is-C (O) R^6C. In the examples, R⁶is-C (O) OR^6C. In the examples, R⁶is-C (O) NR^6AR^6B. In the examples, R⁶is-OR^6D. In the examples, R⁶is-NR^6AC(O)R^6C. In the examples, R⁶is-NR^6AC(O)OR^6C. In the examples, R⁶is-SO₂NR^6AR^6B. In the examples, R⁶is-NR^6ASO₂R^6D. In the examples, R⁶is-C (O) NR^6AOR^6B。

In the examples, R⁶Is substituted or unsubstituted C₁-C₆Alkyl, substituted or unsubstituted 2-to 6-membered heteroalkyl, substituted or unsubstituted C₃-C₆Cycloalkyl, substituted or unsubstituted 3-to 6-membered heterocycloalkyl, substituted or unsubstituted phenyl, or substituted or unsubstituted 5-to 6-membered heteroaryl. In the examples, R⁶Is hydrogen, substituted or unsubstituted C₁-C₈Alkyl or substituted or unsubstituted 2 to 8 membered heteroalkyl.

In the examples, R⁶Independently of one another is halogen, -CX⁶ ₃、-CHX⁶ ₂、-CH₂X⁶、-OCX⁶ ₃、-OCH₂X⁶、-OCHX⁶ ₂、-CN、-SR^6D、-SO₂R^6D、-NR^6AR^6B、-C(O)R^6C、-C(O)OR^6C、-C(O)NR^6AR^6B、-OR^6D、-NR^6AC(O)R^6C、-NR^6AC(O)OR^6CSubstituted or unsubstituted alkyl or substituted or unsubstituted heteroalkyl.

In the examples, R⁶Is by R³⁵Substituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R⁶Is by R³⁵Substituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R⁶Is unsubstituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R⁶Is by R³⁵Substituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R⁶Is by R³⁵Substituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R⁶Is unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R⁶is-O- (substituted or unsubstituted C₁-C₈Alkyl groups). In the examples, R⁶is-O- (substituted or unsubstituted C₁-C₆Alkyl groups). In the examples, R⁶is-O- (substituted or unsubstituted C₁-C₄Alkyl groups). In the examples, R⁶is-OCH₃. In the examples, R⁶Is by R³⁵A substituted or unsubstituted 3-to 8-membered heterocycloalkyl group, wherein the heterocycloalkyl group contains an oxygen atom. In the examples, R⁶Is by R³⁵A substituted or unsubstituted 5-to 6-membered heterocycloalkyl group, wherein the heterocycloalkyl group contains an oxygen atom. In the examples, R⁶Is by R³⁵A substituted or unsubstituted 5-membered heterocycloalkyl group, wherein the heterocycloalkyl group comprises an oxygen atom. In the examples, R⁶Is by R³⁵A substituted or unsubstituted 6-membered heterocycloalkyl group, wherein the heterocycloalkyl group comprises an oxygen atom. In the examples, R⁶Is a substituted or unsubstituted heteroalkyl or substituted or unsubstituted heterocycloalkyl. In the examples, R⁶Is a substituted or unsubstituted 2-to 8-membered heteroalkyl group. In the examples, R⁶Is a substituted or unsubstituted 2-to 6-membered heteroalkyl group. In the examples, R⁶Is a substituted or unsubstituted 2-to 4-membered heteroalkyl group. In the examples, R⁶Is a substituted or unsubstituted 2-membered heteroalkyl group. In the examples, R⁶Is a substituted or unsubstituted 3-membered heteroalkyl group. In the examples, R⁶Is a substituted or unsubstituted 4-membered heteroalkyl group. In the examples, R⁶Is a substituted or unsubstituted 5-membered heteroalkyl group. In the examples, R⁶Is a substituted or unsubstituted 6-membered heteroalkyl group. In the examples, R⁶Is a substituted or unsubstituted 7-membered heteroalkyl group. In the examples, R⁶Is a substituted or unsubstituted 8-membered heteroalkyl group. In the examples, R⁶Is a substituted 2-to 8-membered heteroalkyl group. In the examples, R⁶Is a substituted 2-to 6-membered heteroalkyl group. In the examples, R⁶Is a substituted 2-to 4-membered heteroalkyl group. In the examples, R⁶Is a substituted 2-membered heteroalkyl group. In the examples, R⁶Is a substituted 3-membered heteroalkyl. In the examples, R⁶Is a substituted 4-membered heteroalkyl group. In the examples, R⁶Is a substituted 5-membered heteroalkyl group. In the examples, R⁶Is a substituted 6-membered heteroalkyl group. In the examples, R⁶Is a substituted 7-membered heteroalkyl group. In the examples, R⁶Is a substituted 8-membered heteroalkyl group. In the examples, R⁶Is unsubstituted 2-to 8-membered heteroalkyl. In the examples, R⁶Is unsubstituted 2-to 6-membered heteroalkyl. In the examples, R⁶Is unsubstituted 2-to 4-membered heteroalkyl. In the examples, R⁶Is unsubstituted 2-membered heteroalkyl. In the examples, R⁶Is unsubstituted 3-membered heteroalkyl. In the examples, R⁶Is unsubstituted 4-membered heteroalkyl. In the examples, R⁶Is unsubstituted 5-membered heteroalkyl. In the examples, R⁶Is unsubstituted 6-membered heteroalkyl. In the examples, R⁶Is unsubstituted 7-membered heteroalkyl. In the examples, R⁶Is unsubstituted 8-membered heteroalkyl.

In the examples, R⁶Is by R³⁵Substituted or unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups). In the examples, R⁶Is by R³⁵Substituted cycloalkyl (e.g. C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups). In the examples, R⁶Is unsubstituted cycloalkyl (e.g. C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups).

In the examples, R⁶Is by R³⁵Substituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl). In the examples, R⁶Is by R³⁵Substituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl). In the examples, R⁶Is unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl).

In the examples, R⁶Is by R³⁵Substituted or unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl). In the examples, R⁶Is by R³⁵Substituted aryl radicals (e.g. C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl). In the examples, R⁶Is unsubstituted aryl (e.g. C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl).

In the examples, R⁶Is by R³⁵Substituted or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl). In the examples, R⁶Is by R³⁵Substituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl). In the examples, R⁶Is unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl).

In the examples, R³⁵Independently oxo, halogen, -CCl₃、-CBr₃、-CF₃、-CI₃、CHCl₂、-CHBr₂、-CHF₂、-CHI₂、-CH₂Cl、-CH₂Br、-CH₂F、-CH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂、-NHC(O)NH₂、-NHSO₂H、-NHC(O)H、-NHC(O)OH、-NHOH、-OCCl₃、-OCF₃、-OCBr₃、-OCI₃、-OCHCl₂、-OCHBr₂、-OCHI₂、-OCHF₂、-OCH₂Cl、-OCH₂Br、-OCH₂I、-OCH₂F、-N₃Quilt R³⁶Substituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl), by R³⁶Substituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl), with R³⁶Substituted or unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl), by R³⁶Substituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl), with R³⁶Substituted or unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl) or by R³⁶Substituted or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl).

In the examples, R³⁵Independently unsubstituted phenyl. In the examples, R³⁵Independently an unsubstituted methyl group. In the examples, R³⁵Independently is-CF₃. In the examples, R³⁵Independently is-NH₂. In the examples, R³⁵Independently an unsubstituted benzyl group. In the examples, R³⁵Independently an oxo group. In the examples, R³⁵Independently a halogen. In the examples, R³⁵Independently is-CCl₃. In the examples, R³⁵Independently is-CBr₃. In the examples, R³⁵Independently is-CF₃. In the examples, R³⁵Independently is-CI₃. In the examples, R³⁵Independently is CHCl₂. In the examples, R³⁵Independently is-CHBr₂. In the examples, R³⁵Independently is-CHF₂. In the examples, R³⁵Independently is-CHI₂. In the examples, R³⁵Independently is-CH₂And (4) Cl. In the examples, R³⁵Independently is-CH₂Br is added. In the examples, R³⁵Independently is-CH₂F. In the examples, R³⁵Independently is-CH₂I. In the examples, R³⁵Independently is-CN. In the examples, R³⁵Independently is-OH. In the examples, R³⁵Independently is-NH₂. In the examples, R³⁵independently-COOH. In the examples, R³⁵Independently is-CONH₂. In the examples, R³⁵Independently is-NO₂. In the examples, R³⁵Independently is-SH. In the examples, R³⁵Independently is-SO₃H. In the examples, R³⁵Independently is-SO₄H. In the examples, R³⁵Independently is-SO₂NH₂. In the examples, R³⁵Independently is-NHNH₂. In the examples, R³⁵Independently is-ONH₂. In the examples, R³⁵Independently is-NHC (O) NHNH₂. In the examples, R³⁵Independently is-NHC (O) NH₂. In the examples, R³⁵Independently is-NHSO₂H. In the examples, R³⁵independently-NHC (O) H. In the examples, R³⁵independently-NHC (O) OH. In the examples, R³⁵independently-NHOH. In the examples, R³⁵Independently is-OCCl₃. In the examples, R³⁵Independently is-OCF₃. In the examples, R³⁵Independently is-OCBr₃. In the examples, R³⁵Independently is-OCI₃. In the examples, R³⁵Independently is-OCHCl₂. In the examples, R³⁵Independently is-OCHBr₂. In the examples, R³⁵Independently is-OCHI₂. In the examples, R³⁵Independently is-OCHF₂. In the examples, R³⁵Independently is-OCH₂And (4) Cl. In the examples, R³⁵Independently is-OCH₂Br is added. In the examples, R³⁵Independently is-OCH₂I. In the examples, R³⁵Independently is-OCH₂F. In the examples, R³⁵Independently is-O (C)₄Alkyl groups). In the examples, R³⁵Independently isIn the examples, R³⁵Independently is

In the examples, R³⁵Is by R³⁶Substituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R³⁵Is by R³⁶Substituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R³⁵Is unsubstituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups).

In the examples, R³⁵Is by R³⁶Substituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R³⁵Is by R³⁶Substituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R³⁵Is unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R³⁵Is a substituted or unsubstituted 2-to 8-membered heteroalkyl group. In the examples, R³⁵Is a substituted or unsubstituted 2-to 6-membered heteroalkyl group. In the examples, R³⁵Is a substituted or unsubstituted 2-to 4-membered heteroalkyl group. In the examples, R³⁵Is a substituted or unsubstituted 2-membered heteroalkyl group. In the examples, R³⁵Is a substituted or unsubstituted 3-membered heteroalkyl group. In the examples, R³⁵Is a substituted or unsubstituted 4-membered heteroalkyl group. In the examples, R³⁵Is a substituted or unsubstituted 5-membered heteroalkyl group. In the examples, R³⁵Is a substituted or unsubstituted 6-membered heteroalkyl group. In the examples, R³⁵Is a substituted or unsubstituted 7-membered heteroalkyl group. In the examples, R³⁵Is a substituted or unsubstituted 8-membered heteroalkyl group. In the examples, R³⁵Is a substituted 2-to 8-membered heteroalkyl group. In the examples, R³⁵Is a substituted 2-to 6-membered heteroalkyl group. In the examples, R³⁵Is a substituted 2-to 4-membered heteroalkyl group. In the examples, R³⁵Is a substituted 2-membered heteroalkyl group. In the examples, R³⁵Is a substituted 3-membered heteroalkyl. In the examples, R³⁵Is a substituted 4-membered heteroalkyl group. In the examples, R³⁵Is a substituted 5-membered heteroalkyl group. In the examples, R³⁵Is a substituted 6-membered heteroalkyl group. In the examples, R³⁵Is a substituted 7-membered heteroalkyl group. In the examples, R³⁵Is a substituted 8-membered heteroalkyl group. In the examples, R³⁵Is unsubstituted 2-to 8-membered heteroalkyl. In the examples, R³⁵Is unsubstituted 2-to 6-membered heteroalkyl. In the examples, R³⁵Is unsubstituted 2-to 4-membered heteroalkyl. In the examples, R³⁵Is unsubstituted 2-membered heteroalkyl. In the examples, R³⁵Is unsubstituted 3-membered heteroalkyl. In the examples, R³⁵Is unsubstituted 4-membered heteroalkyl. In the examples, R³⁵Is unsubstituted 5-membered heteroalkyl. In the examples, R³⁵Is unsubstituted 6-membered heteroalkyl. In the examples, R³⁵Is unsubstituted 7-membered heteroalkyl. In the examples, R³⁵Is unsubstituted 8-membered heteroalkyl.

In the examples, R³⁵Is by R³⁶Substituted or unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups). In the examples, R³⁵Is by R³⁶Substituted cycloalkyl (e.g. C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups). In the examples, R³⁵Is unsubstituted cycloalkyl (e.g. C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups).

In the examples, R³⁵Is by R³⁶Substituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl). In the examples, R³⁵Is by R³⁶Substituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl). In the examples, R³⁵Is unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl). In the examples, R³⁵Is by R³⁶Substituted or unsubstituted 3-to 8-membered heterocycloalkyl. In the examples, R³⁵Is by R³⁶Substituted 3 to 8 membered heterocycloalkyl. In the examples, R³⁵Is unsubstituted 3-to 8-membered heterocycloalkyl. In the examples, R³⁵Is by R³⁶Substituted or unsubstituted 3-to 6-membered heterocycloalkyl. In the examples, R³⁵Is by R³⁶Substituted 3 to 6 membered heterocycloalkyl. In the examples, R³⁵Is unsubstituted 3-to 6-membered heterocycloalkyl. In the examples, R³⁵Is by R³⁶Substituted or unsubstituted 5-to 6-membered heterocycloalkyl. In the examples, R³⁵Is by R³⁶Substituted 5 to 6 membered heterocycloalkyl. In the examples, R³⁵Is unsubstituted 5-to 6-membered heterocycloalkyl.

In the examples, R³⁵Is by R³⁶Substituted or unsubstitutedAryl (e.g. C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl). In the examples, R³⁵Is by R³⁶Substituted aryl radicals (e.g. C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl). In the examples, R³⁵Is unsubstituted aryl (e.g. C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl).

In the examples, R³⁵Is by R³⁶Substituted or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl). In the examples, R³⁵Is by R³⁶Substituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl). In the examples, R³⁵Is unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl).

In the examples, R³⁵Is that

In an embodiment, z36 is 0. In an embodiment, z36 is 1. In an embodiment, z36 is 2. In an embodiment, z36 is 3. In an embodiment, z36 is 4. In an embodiment, z36 is 5. In an embodiment, z36 is 6. In an embodiment, z36 is 7. In an embodiment, z36 is 8. In an embodiment, z36 is an integer from 1 to 3. In an embodiment, z36 is an integer from 1 to 2. In an embodiment, z36 is an integer from 1 to 4.

In the examples, R³⁵The method comprises the following steps:

in the examples, R³⁵The method comprises the following steps:

in the examples, R³⁵Is thatIn the examples, R³⁵Is thatIn the examples, R³⁵Is that

In the examples, R³⁵Is thatIn the examples, R³⁵Is that

In the examples, R³⁵Is that

In the examples, R³⁵Is thatIn the examples, R³⁵Is thatIn the examples, R³⁵Is thatIn the examples, R³⁵Is thatIn the examples, R³⁵Is thatIn the examples, R³⁵Is thatIn the examples, R³⁵Is thatIn the examples, R³⁵Is that

In the examples, R³⁵Is that

In the examples, R³⁵Is thatIn the examples, R³⁵Is that

In the examples, R³⁵Is that

In the examples, R³⁵Is thatIn the examples, R³⁵Is that

In the examples, R³⁵Is thatIn the examples, R³⁵Is thatIn the examples, R³⁵Is thatIn the examples, R³⁵Is thatIn the examples, R³⁵Is thatIn the examples, R³⁵Is that

In the examples, R³⁵Is thatIn the examples, R³⁵Is thatIn the examples, R³⁵Is that

In the examples, R³⁵Is thatIn the examples, R³⁵Is that

In the examples, R³⁵Is that

In the examples, R³⁵Is thatIn the examples, R³⁵Is thatIn the examples, R³⁵Is thatIn the examples, R³⁵Is thatIn the examples, R³⁵Is thatIn the examples, R³⁵Is that

In the examples, R³⁵Is that

In the examples, R³⁵Is thatIn the examples, R³⁵Is that

In the examples, R³⁵Is thatIn the examples, R³⁵Is thatIn the examples, R³⁵Is thatIn the examples, R³⁵Is that

In the examples, R³⁵Is that

In the examples, R³⁵Is thatIn the examples, R³⁵Is thatIn the examples, R³⁵Is thatIn the examples, R³⁵Is that

In the examples, R³⁶The method comprises the following steps:

wherein R is³⁷Are independent and as described herein. The symbol z37 is an integer from 0 to 10. In an embodiment, z37 is 0. In an embodiment, z37 is 1. In an embodiment, z37 is 2.

In the examples, R³⁶The method comprises the following steps:

in the examples, R³⁶The method comprises the following steps:

in the examples, R³⁶Is that

In the examples, R³⁶Is that

In the examples, R³⁶Is thatIn the examples, R³⁶Is thatIn the examples, R³⁶Is that

In the examples, R³⁶Is thatIn the examples, R³⁶Is that

In the examples, R³⁶Is that

In the examples, R³⁶Is thatIn the examples, R³⁶Is thatIn the examples, R³⁶Is thatIn the examples, R³⁶Is thatIn the examples, R³⁶Is thatIn the examples, R³⁶Is thatIn the examples, R³⁶Is that

In the examples, R³⁶Is that

In the examples, R³⁶Is thatIn the examples, R³⁶Is thatIn the examples, R³⁶Is thatIn the examples, R³⁶Is that

In the examples, R³⁶Is thatIn the examples, R³⁶Is that

In the examples, R³⁶Is thatIn the examples, R³⁶Is thatIn the examples, R³⁶Is that

In the examples, R³⁶Is thatIn the examples, R³⁶Is that

In the examples, R³⁶Is that

In the examples, R³⁶Is thatIn the examples, R³⁶Is that

In the examples, R³⁶Is thatIn the examples, R³⁶Is thatIn the examples, R³⁶Is that

In the examples, R³⁶Is that

In the examples, R³⁶Is thatIn the examples, R³⁶Is that

In the examples, R³⁶Is that

In the examples, R³⁶Is thatIn the examples, R³⁶Is thatIn the examples, R³⁶Is thatIn the examples, R³⁶Is thatIn the examples, R³⁶Is that

In the examples, R³⁶Is thatIn the examples, R³⁶Is that

In the examples，R³⁶Is thatIn the examples, R³⁶Is thatIn the examples, R³⁶Is that

In the examples, R³⁶Is thatIn the examples, R³⁶Is that

In the examples, R³⁶Is that

In the examples, R³⁶Is thatIn the examples, R³⁶Is that

In the examples, R³⁶Is thatIn the examples, R³⁶Is thatIn the examples, R³⁶Is thatIn the examples, R³⁶Is that

In the examples, R³⁶Is thatIn the examples, R³⁶Is that

In the examples, R³⁶Is that

In the examples, R⁶Independently of one another is halogen, -CX⁶ ₃、-CHX⁶ ₂、-CH₂X⁶、-OCX⁶ ₃、-OCH₂X⁶、-OCHX⁶ ₂、-NR^6AR^6B、-C(O)R^6CC substituted or unsubstituted₁-C₆Alkyl, substituted or unsubstituted 2 to 6 membered heteroalkyl. In the examples, R⁶Independently of one another is halogen, -CX⁶ ₃、-CHX⁶ ₂、-CH₂X⁶、-OCX⁶ ₃、-OCH₂X⁶、-OCHX⁶ ₂、-CN、-SR^6D、-SO₂R^6D、-NR^6AR^6B、-C(O)R^6C、-C(O)OR^6C、-C(O)NR^6AR^6B、-OR^6D、-NR^6AC(O)R^6C、-NR^6AC(O)OR^6CC substituted or unsubstituted₁-C₆Alkyl, substituted or unsubstituted 2 to 6 membered heteroalkyl. In the examples, R⁶Independently is-C (O) R^6C、-C(O)OR^6C、-C(O)NR^6AR^6B、-OR^6D、-NR^6AC(O)R^6C、-NR^6AC(O)OR^6CC substituted or unsubstituted₁-C₆Alkyl, substituted or unsubstituted 2 to 6 membered heteroalkyl. In the examples, R⁶is-F, -OH, -OCH₃、-OCH₂CH₃、-CH₂OH、-CH₂OCH₃、-NHC(O)CH₃、-CH₃、-N(CH₃)₂、-CH₂NH₂、-CH₂N(CH₃)₂、-NH₂、-NHCH₃-COOH or-SO₂CH₃. In the examples, R⁶is-OH, -OCH₃、-OCH₂CH₃、-CH₂OH or-CH₂OCH₃. In the examples, R⁶Is substituted or unsubstituted C₁-C₆Alkyl or substituted or unsubstituted 2 to 6 membered heteroalkyl. In the examples, R⁶Is by R³⁵Substituted or unsubstituted C₁-C₆Alkyl or by R³⁵Substituted or unsubstituted 2-to 6-membered heteroalkyl.

In the examples, R^6AIs hydrogen, halogen, CF₃、-CBr₃、-CCl₃、-CI₃、-CHF₂、-CHBr₂、-CHCl₂、-CHI₂、-CH₂F、-CH₂Br、-CH₂Cl、-CH₂I、-OCF₃、-OCBr₃、-OCCl₃、-OCI₃、-OCHF₂、-OCHBr₂、-OCHCl₂、-OCHI₂、-OCH₂F、-OCH₂Br、-OCH₂Cl、-OCH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂Quilt R^35ASubstituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl), by R^35ASubstituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl), with R^35ASubstituted or unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl), by R^35ASubstituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl), with R^35ASubstituted or unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl) or by R^35ASubstituted or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl).

In the examples, R^6AIs by R^35ASubstituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^6AIs by R^35ASubstituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^6AIs unsubstituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^6AIs by R^35ASubstituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R^6AIs by R^35ASubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R^6AIs unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R^6Ais-O- (substituted or unsubstituted C₁-C₈Alkyl groups). In the examples, R^6Ais-O- (substituted or unsubstituted C₁-C₆Alkyl groups). In the examples, R^6Ais-O- (substituted or unsubstituted C₁-C₄Alkyl groups). In the examples, R^6Ais-OCH₃. In the examples, R^6AIs by R^35AA substituted or unsubstituted 3-to 8-membered heterocycloalkyl group, wherein the heterocycloalkyl group contains an oxygen atom. In the examples, R^6AIs by R^35AA substituted or unsubstituted 5-to 6-membered heterocycloalkyl group, wherein the heterocycloalkyl group contains an oxygen atom. In the examples, R^6AIs by R^35AA substituted or unsubstituted 5-membered heterocycloalkyl group, wherein the heterocycloalkyl group comprises an oxygen atom. In the examples, R^6AIs by R^35AA substituted or unsubstituted 6-membered heterocycloalkyl group, wherein the heterocycloalkyl group comprises an oxygen atom.

In the examples, R^6AIs by R^35ASubstituted or unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups). In the examples, R^6AIs by R^35ASubstituted cycloalkyl (e.g. C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups). In the examples, R^6AIs unsubstituted cycloalkyl (e.g. C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups).

In the examples, R^6AIs by R^35ASubstituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl). In the examples, R^6AIs by R^35ASubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl). In the examples, R^6AIs unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl).

In the examples, R^6AIs by R^35ASubstituted or unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl). In the examples, R^6AIs by R^35ASubstituted aryl radicals (e.g. C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl). In the examples, R^6AIs unsubstituted aryl (e.g. C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl).

In the examples, R^6AIs by R^35ASubstituted or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl). In the examples, R^6AIs by R^35ASubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl). In the examples, R^6AIs unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl).

In the examples, R^6AThe method comprises the following steps:

in the examples, R^6AThe method comprises the following steps:in the examples, R^6AIs thatIn the examples, R^6AIs thatIn the examples, R^6AIs that

In the examples, R^6AIs thatIn the examples, R^6AIs thatIn the examples, R^6AIs that

In the examples, R^6AIs thatIn the examples, R^6AIs that

In the examples, R^6AIs thatIn the examples, R^6AIs thatIn the examples, R^6AIs thatIn the examples, R^6AIs that

In the examples, R^6AIs thatIn the examples, R^6AIs that

In the examples, R^6AIs that

In the examples, R^6AIs thatIn the examples, R^6AIs that

In the examples, R^6AIs thatIn the examples, R^6AIs thatIn the examples, R^6AIs thatIn the examples, R^6AIs that

In the examples, R^6AIs thatIn the examples, R^6AIs thatIn the examples, R^6AIs that

In the examples, R^6AIs that

In the examples, R^6AIs thatIn the examples, R^6AIs thatIn the examples, R^6AIs thatIn the examples, R^6AIs that

In the examples, R^6AIs thatIn the examples, R^6AIs that

In the examples, R^6AIs thatIn the examples, R^6AIs thatIn the examples, R^6AIs that

In the examples, R^6AIs that

In the examples, R^6AIs thatIn the examples, R^6AIs thatIn the examples, R^6AIs that

In the examples, R^6AIs that

In the examples, R^6AIs thatIn the examples, R^6AIs thatIn the examples, R^6AIs thatIn the examples, R^6AIs thatIn the examples, R^6AIs thatIn the examples, R^6AIs that

In the examples, R^6AIs thatIn the examples, R^6AIs thatIn the examples, R^6AIs thatIn the examples, R^6AIs thatIn the examples, R^6AIs that

In the examples, R^6AIs that

In the examples, R^6AIs thatIn the examples, R^6AIs that

In the examples, R^6AIs that

In the examples, R^6AIs thatIn the examples, R^6AIs thatIn the examples, R^6AIs thatIn the examples, R^6AIs that

R^35AIs oxo, halogen, -CCl₃、-CBr₃、-CF₃、-CI₃、CHCl₂、-CHBr₂、-CHF₂、-CHI₂、-CH₂Cl、-CH₂Br、-CH₂F、-CH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂、-NHC(O)NH₂、-NHSO₂H、-NHC(O)H、-NHC(O)OH、-NHOH、-OCCl₃、-OCF₃、-OCBr₃、-OCI₃、-OCHCl₂、-OCHBr₂、-OCHI₂、-OCHF₂、-OCH₂Cl、-OCH₂Br、-OCH₂I、-OCH₂F. Substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. In the examples, R^35AIndependently oxo, halogen, -CCl₃、-CBr₃、-CF₃、-CI₃、CHCl₂、-CHBr₂、-CHF₂、-CHI₂、-CH₂Cl、-CH₂Br、-CH₂F、-CH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂、-NHC(O)NH₂、-NHSO₂H、-NHC(O)H、-NHC(O)OH、-NHOH、-OCCl₃、-OCF₃、-OCBr₃、-OCI₃、-OCHCl₂、-OCHBr₂、-OCHI₂、-OCHF₂、-OCH₂Cl、-OCH₂Br、-OCH₂I、-OCH₂F、-N₃Quilt R^36ASubstituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl), by R^36ASubstituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl), with R^36ASubstituted or unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl), by R^36ASubstituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl 35} or 5-to 6-membered heterocycloalkyl), with R^36ASubstituted or unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl) or by R^36ASubstituted or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl).

In the examples, R^35AIndependently unsubstituted phenyl. In the examples, R^35AIndependently an unsubstituted methyl group. In the examples, R^35AIndependently is-CF₃. In the examples, R^35AIndependently is-NH₂. In the examples, R^35AIndependently an unsubstituted benzyl group. In the examples, R^35AIndependently an oxo group. In the examples, R^35AIndependently a halogen. In the examples, R^35AIndependently is-CCl₃. In the examples, R^35AIndependently is-CBr₃. In the examples, R^35AIndependently is-CF₃. In the examples, R^35AIndependently is-CI₃. In the examples, R^35AIndependently is CHCl₂. In the examples, R^35AIndependently is-CHBr₂. In the examples, R^35AIndependently is-CHF₂. In the examples, R^35AIndependently is-CHI₂. In the examples, R^35AIndependently is-CH₂And (4) Cl. In the examples, R^35AIndependently is-CH₂Br is added. In the examples, R^35AIndependently is-CH₂F。In the examples, R^35AIndependently is-CH₂I. In the examples, R^35AIndependently is-CN. In the examples, R^35AIndependently is-OH. In the examples, R^35AIndependently is-NH₂. In the examples, R^35Aindependently-COOH. In the examples, R^35AIndependently is-CONH₂. In the examples, R^35AIndependently is-NO₂. In the examples, R^35AIndependently is-SH. In the examples, R^35AIndependently is-SO₃H. In the examples, R^35AIndependently is-SO₄H. In the examples, R^35AIndependently is-SO₂NH₂. In the examples, R^35AIndependently is-NHNH₂. In the examples, R^35AIndependently is-ONH₂. In the examples, R^35AIndependently is-NHC (O) NHNH₂. In the examples, R^35AIndependently is-NHC (O) NH₂. In the examples, R^35AIndependently is-NHSO₂H. In the examples, R^35Aindependently-NHC (O) H. In the examples, R^35Aindependently-NHC (O) OH. In the examples, R^35Aindependently-NHOH. In the examples, R^35AIndependently is-OCCl₃. In the examples, R^35AIndependently is-OCF₃. In the examples, R^35AIndependently is-OCBr₃. In the examples, R^35AIndependently is-OCI₃. In the examples, R^35AIndependently is-OCHCl₂. In the examples, R^35AIndependently is-OCHBr₂. In the examples, R^35AIndependently is-OCHI₂. In the examples, R^35AIndependently is-OCHF₂. In the examples, R^35AIndependently is-OCH₂And (4) Cl. In the examples, R^35AIndependently is-OCH₂Br is added. In the examples, R^35AIndependently is-OCH₂I. In the examples, R^35AIndependently is-OCH₂F。

R^36AIndependently oxo, halogen, -CCl₃、-CBr₃、-CF₃、-CI₃、CHCl₂、-CHBr₂、-CHF₂、-CHI₂、-CH₂Cl、-CH₂Br、-CH₂F、-CH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂、-NHC(O)NH₂、-NHSO₂H、-NHC(O)H、-NHC(O)OH、-NHOH、-OCCl₃、-OCF₃、-OCBr₃、-OCI₃、-OCHCl₂、-OCHBr₂、-OCHI₂、-OCHF₂、-OCH₂Cl、-OCH₂Br、-OCH₂I、-OCH₂F、-N₃Quilt R^37ASubstituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl), by R^37ASubstituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl), with R^37ASubstituted or unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl), by R^37ASubstituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl), with R^37ASubstituted or unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl) or by R^37ASubstituted or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl).

In the examples, R^6BIs hydrogen, halogen, CF₃、-CBr₃、-CCl₃、-CI₃、-CHF₂、-CHBr₂、-CHCl₂、-CHI₂、-CH₂F、-CH₂Br、-CH₂Cl、-CH₂I、-OCF₃、-OCBr₃、-OCCl₃、-OCI₃、-OCHF₂、-OCHBr₂、-OCHCl₂、-OCHI₂、-OCH₂F、-OCH₂Br、-OCH₂Cl、-OCH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂Quilt R^35BSubstituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl), by R^35BSubstituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl), with R^35BSubstituted or unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl), by R^35BSubstituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl), with R^35BSubstituted or unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl) or by R^35BSubstituted or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl).

In the examples, R^6BIs by R^35BSubstituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^6BIs by R^35BSubstituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^6BIs unsubstituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^6BIs by R^35BSubstituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R^6BIs by R^35BSubstituted heteroalkyl groups (e.g. 2 to 8 membered)Heteroalkyl, 2 to 6 membered heteroalkyl, or 2 to 4 membered heteroalkyl). In the examples, R^6BIs unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R^6Bis-O- (substituted or unsubstituted C₁-C₈Alkyl groups). In the examples, R^6Bis-O- (substituted or unsubstituted C₁-C₆Alkyl groups). In the examples, R^6Bis-O- (substituted or unsubstituted C₁-C₄Alkyl groups). In the examples, R^6Bis-OCH₃. In the examples, R^6BIs by R^35BA substituted or unsubstituted 3-to 8-membered heterocycloalkyl group, wherein the heterocycloalkyl group contains an oxygen atom. In the examples, R^6BIs by R^35BA substituted or unsubstituted 5-to 6-membered heterocycloalkyl group, wherein the heterocycloalkyl group contains an oxygen atom. In the examples, R^6BIs by R^35BA substituted or unsubstituted 5-membered heterocycloalkyl group, wherein the heterocycloalkyl group comprises an oxygen atom. In the examples, R^6BIs by R^35BA substituted or unsubstituted 6-membered heterocycloalkyl group, wherein the heterocycloalkyl group comprises an oxygen atom.

In the examples, R^6BIs by R^35BSubstituted or unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups). In the examples, R^6BIs by R^35BSubstituted cycloalkyl (e.g. C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups). In the examples, R^6BIs unsubstituted cycloalkyl (e.g. C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups).

In the examples, R^6BIs by R^35BSubstituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl). In the examples, R^6BIs by R^35BSubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl)Or 5 to 6 membered heterocycloalkyl). In the examples, R^6BIs unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl).

In the examples, R^6BIs by R^35BSubstituted or unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl). In the examples, R^6BIs by R^35BSubstituted aryl radicals (e.g. C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl). In the examples, R^6BIs unsubstituted aryl (e.g. C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl).

In the examples, R^6BIs by R^35BSubstituted or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl). In the examples, R^6BIs by R^35BSubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl). In the examples, R^6BIs unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl).

In the examples, R^6BThe method comprises the following steps:

in the examples, R^6BThe method comprises the following steps:in the examples, R^6BIs thatIn the examples, R^6BIs that

In the examples, R^6BIs that

In the examples, R^6BIs thatIn the examples, R^6BIs that

In the examples, R^6BIs thatIn the examples, R^6BIs thatIn the examples, R^6BIs that

In the examples, R^6BIs that

In the examples, R^6BIs thatIn the examples, R^6BIs that

In the examples, R^6BIs that

In the examples, R^6BIs thatIn the examples, R^6BIs thatIn the examples, R^6BIs thatIn the examples, R^6BIs that

In the examples, R^6BIs thatIn the examples, R^6BIs that

In the examples, R^6BIs that

In the examples, R^6BIs thatIn the examples, R^6BIs thatIn the examples, R^6BIs that

In the examples, R^6BIs that

In the examples, R^6BIs thatIn the examples, R^6BIs thatIn the examples, R^6BIs thatIn the examples, R^6BIs thatIn the examples, R^6BIs thatIn the examples, R^6BIs thatIn the examples, R^6BIs thatIn the examples, R^6BIs thatIn the examples, R^6BIs that

In the examples, R^6BIs thatIn the examples, R^6BIs that

In the examples, R^6BIs that

In the examples, R^6BIs thatIn the examples, R^6BIs thatIn the examples, R^6BIs thatIn the examples, R^6BIs that

In the examples, R^6BIs that

In the examples, R^6BIs thatIn the examples, R^6BIs that

In the examples, R^6BIs that

In the examples, R^6BIs thatIn the examples, R^6BIs thatIn the examples, R^6BIs thatIn the examples, R^6BIs thatIn an embodiment of the present invention,R^6Bis that

In the examples, R^6BIs thatIn the examples, R^6BIs thatIn the examples, R^6BIs thatIn the examples, R^6BIs that

In the examples, R^6BIs that

In the examples, R^6BIs thatIn the examples, R^6BIs thatIn the examples, R^6BIs that

In the examples, R^6BIs that

In the examples, R^6BIs thatIn the examples, R^6BIs thatIn the examples, R^6BIs that

R^35BIs oxo, halogen, -CCl₃、-CBr₃、-CF₃、-CI₃、CHCl₂、-CHBr₂、-CHF₂、-CHI₂、-CH₂Cl、-CH₂Br、-CH₂F、-CH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂、-NHC(O)NH₂、-NHSO₂H、-NHC(O)H、-NHC(O)OH、-NHOH、-OCCl₃、-OCF₃、-OCBr₃、-OCI₃、-OCHCl₂、-OCHBr₂、-OCHI₂、-OCHF₂、-OCH₂Cl、-OCH₂Br、-OCH₂I、-OCH₂F. Substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. In the examples, R^35BIndependently oxo, halogen, -CCl₃、-CBr₃、-CF₃、-CI₃、CHCl₂、-CHBr₂、-CHF₂、-CHI₂、-CH₂Cl、-CH₂Br、-CH₂F、-CH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂、-NHC(O)NH₂、-NHSO₂H、-NHC(O)H、-NHC(O)OH、-NHOH、-OCCl₃、-OCF₃、-OCBr₃、-OCI₃、-OCHCl₂、-OCHBr₂、-OCHI₂、-OCHF₂、-OCH₂Cl、-OCH₂Br、-OCH₂I、-OCH₂F、-N₃Quilt R^36BSubstituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl), by R^36BSubstituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl), with R^36BSubstituted or unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl), by R^36BSubstituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl), with R^36BSubstituted or unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl) or by R^36BSubstituted or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl).

In the examples, R^35BIndependently unsubstituted phenyl. In the examples, R^35BIndependently an unsubstituted methyl group. In the examples, R^35BIndependently is-CF₃. In the examples, R^35BIndependently is-NH₂. In the examples, R^35BIndependently an unsubstituted benzyl group. In the examples, R^35BIndependently an oxo group. In the examples, R^35BIndependently a halogen. In the examples, R^35BIndependently is-CCl₃. In the examples, R^35BIndependently is-CBr₃. In the examples, R^35BIndependently is-CF₃. In the examples, R^35BIndependently is-CI₃. In the examples, R^35BIndependently is CHCl₂. In the examples, R^35BIndependently is-CHBr₂. In the implementation ofIn the examples, R^35BIndependently is-CHF₂. In the examples, R^35BIndependently is-CHI₂. In the examples, R^35BIndependently is-CH₂And (4) Cl. In the examples, R^35BIndependently is-CH₂Br is added. In the examples, R^35BIndependently is-CH₂F. In the examples, R^35BIndependently is-CH₂I. In the examples, R^35BIndependently is-CN. In the examples, R^35BIndependently is-OH. In the examples, R^35BIndependently is-NH₂. In the examples, R^35Bindependently-COOH. In the examples, R^35BIndependently is-CONH₂. In the examples, R^35BIndependently is-NO₂. In the examples, R^35BIndependently is-SH. In the examples, R^35BIndependently is-SO₃H. In the examples, R^35BIndependently is-SO₄H. In the examples, R^35BIndependently is-SO₂NH₂. In the examples, R^35BIndependently is-NHNH₂. In the examples, R^35BIndependently is-ONH₂. In the examples, R^35BIndependently is-NHC (O) NHNH₂. In the examples, R^35BIndependently is-NHC (O) NH₂. In the examples, R^35BIndependently is-NHSO₂H. In the examples, R^35Bindependently-NHC (O) H. In the examples, R^35Bindependently-NHC (O) OH. In the examples, R^35Bindependently-NHOH. In the examples, R^35BIndependently is-OCCl₃. In the examples, R^35BIndependently is-OCF₃. In the examples, R^35BIndependently is-OCBr₃. In the examples, R^35BIndependently is-OCI₃. In the examples, R^35BIndependently is-OCHCl₂. In the examples, R^35BIndependently is-OCHBr₂. In the examples, R^35BIndependently is-OCHI₂. In the examples, R^35BIndependently is-OCHF₂. In the examples, R^35BIndependently is-OCH₂And (4) Cl. In the examples, R^35BIndependently is-OCH₂Br is added. In the examples, R^35BIndependently is-OCH₂I. In the examples, R^35BIndependently is-OCH₂F。

R^36BIndependently oxo, halogen, -CCl₃、-CBr₃、-CF₃、-CI₃、CHCl₂、-CHBr₂、-CHF₂、-CHI₂、-CH₂Cl、-CH₂Br、-CH₂F、-CH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂、-NHC(O)NH₂、-NHSO₂H、-NHC(O)H、-NHC(O)OH、-NHOH、-OCCl₃、-OCF₃、-OCBr₃、-OCI₃、-OCHCl₂、-OCHBr₂、-OCHI₂、-OCHF₂、-OCH₂Cl、-OCH₂Br、-OCH₂I、-OCH₂F、-N₃Quilt R^37BSubstituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl), by R^37BSubstituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl), with R^37BSubstituted or unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl), by R^37BSubstituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl), with R^37BSubstituted or unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl) or by R^37BSubstituted or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl).

In the examples, R^6CIs hydrogen, halogen, CF₃、-CBr₃、-CCl₃、-CI₃、-CHF₂、-CHBr₂、-CHCl₂、-CHI₂、-CH₂F、-CH₂Br、-CH₂Cl、-CH₂I、-OCF₃、-OCBr₃、-OCCl₃、-OCI₃、-OCHF₂、-OCHBr₂、-OCHCl₂、-OCHI₂、-OCH₂F、-OCH₂Br、-OCH₂Cl、-OCH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂Quilt R^35CSubstituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl), by R^35CSubstituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl), with R^35CSubstituted or unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl), by R^35CSubstituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl), with R^35CSubstituted or unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl) or by R^35CSubstituted or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl).

In the examples, R^6CIs by R^35CSubstituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^6CIs by R^35CSubstituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^6CIs unsubstituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^6CIs by R^35CSubstituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R^6CIs by R^35CSubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R^6CIs unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R^6Cis-O- (substituted or unsubstituted C₁-C₈Alkyl groups). In the examples, R^6Cis-O- (substituted or unsubstituted C₁-C₆Alkyl groups). In the examples, R^6Cis-O- (substituted or unsubstituted C₁-C₄Alkyl groups). In the examples, R^6Cis-OCH₃. In the examples, R^6CIs by R^35CA substituted or unsubstituted 3-to 8-membered heterocycloalkyl group, wherein the heterocycloalkyl group contains an oxygen atom. In the examples, R^6CIs by R^35CA substituted or unsubstituted 5-to 6-membered heterocycloalkyl group, wherein the heterocycloalkyl group contains an oxygen atom. In the examples, R^6CIs by R^35CA substituted or unsubstituted 5-membered heterocycloalkyl group, wherein the heterocycloalkyl group comprises an oxygen atom. In the examples, R^6CIs by R^35CA substituted or unsubstituted 6-membered heterocycloalkyl group, wherein the heterocycloalkyl group comprises an oxygen atom.

In the examples, R^6CIs by R^35CSubstituted or unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups). In the examples, R^6CIs by R^35CSubstituted cycloalkyl (e.g. C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups). In the examples, R^6CIs unsubstituted cycloalkyl (e.g. C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups).

In the examples, R^6CIs by R^35CSubstituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl). In the examples, R^6CIs by R^35CSubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl). In the examples, R^6CIs unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl).

In the examples, R^6CIs by R^35CSubstituted or unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl). In the examples, R^6CIs by R^35CSubstituted aryl radicals (e.g. C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl). In the examples, R^6CIs unsubstituted aryl (e.g. C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl).

In the examples, R^6CIs by R^35CSubstituted or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl). In the examples, R^6CIs by R^35CSubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl). In the examples, R^6CIs unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl).

In the examples, R^6CThe method comprises the following steps:

in the examples, R^6CThe method comprises the following steps:

in the examples, R^6CIs thatIn the examples, R^6CIs thatIn the examples, R^6CIs thatIn the examples, R^6CIs that

In the examples, R^6CIs that

In the examples, R^6CIs thatIn the examples, R^6CIs thatIn the examples, R^6CIs thatIn the examples, R^6CIs thatIn the examples, R^6CIs that

In the examples, R^6CIs that

In the examples, R^6CIs thatIn the examples, R^6CIs that

In the examples, R^6CIs that

In the examples, R^6CIs thatIn the examples, R^6CIs thatIn the examples, R^6CIs that

In the examples, R^6CIs thatIn the examples, R^6CIs thatIn the examples, R^6CIs thatIn the examples, R^6CIs thatIn the examples, R^6CIs that

In the examples, R^6CIs that

In the examples, R^6CIs thatIn the examples, R^6CIs thatIn the examples, R^6CIs thatIn the examples, R^6CIs thatIn the examples, R^6CIs that

In the examples, R^6CIs thatIn the examples, R^6CIs that

In the examples, R^6CIs that

In the examples, R^6CIs thatIn the examples, R^6CIs thatIn the examples, R^6CIs that

In the examples, R^6CIs thatIn the examples, R^6CIs that

In the examples, R^6CIs that

In the examples, R^6CIs thatIn the examples, R^6CIs that

In the examples, R^6CIs thatIn the examples, R^6CIs thatIn the examples, R^6CIs thatIn the examples, R^6CIs thatIn the examples, R^6CIs thatIn the examples, R^6CIs thatIn the examples, R^6CIs thatIn the examples, R^6CIs thatIn the examples, R^6CIs thatIn the examples, R^6CIs that

R^35CIs oxo, halogen, -CCl₃、-CBr₃、-CF₃、-CI₃、CHCl₂、-CHBr₂、-CHF₂、-CHI₂、-CH₂Cl、-CH₂Br、-CH₂F、-CH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂、-NHC(O)NH₂、-NHSO₂H、-NHC(O)H、-NHC(O)OH、-NHOH、-OCCl₃、-OCF₃、-OCBr₃、-OCI₃、-OCHCl₂、-OCHBr₂、-OCHI₂、-OCHF₂、-OCH₂Cl、-OCH₂Br、-OCH₂I、-OCH₂F. Substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. In the examples, R^35CIndependently oxo, halogen, -CCl₃、-CBr₃、-CF₃、-CI₃、CHCl₂、-CHBr₂、-CHF₂、-CHI₂、-CH₂Cl、-CH₂Br、-CH₂F、-CH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂、-NHC(O)NH₂、-NHSO₂H、-NHC(O)H、-NHC(O)OH、-NHOH、-OCCl₃、-OCF₃、-OCBr₃、-OCI₃、-OCHCl₂、-OCHBr₂、-OCHI₂、-OCHF₂、-OCH₂Cl、-OCH₂Br、-OCH₂I、-OCH₂F、-N₃Quilt R^36CSubstituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical C₁-C₆Alkyl or C₁-C₄Alkyl), by R^36CSubstituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl), with R^36CSubstituted or unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl), by R^36CSubstituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl), with R^36CSubstituted or unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl) or by R^36CSubstituted or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl).

In the examples, R^35CIndependently unsubstituted phenyl. In the examples, R^35CIndependently an unsubstituted methyl group. In the examples, R^35CIndependently is-CF₃. In the examples, R^35CIndependently is-NH₂. In the examples, R^35CIndependently an unsubstituted benzyl group. In the examples, R^35CIndependently an oxo group. In the examples, R^35CIndependently a halogen. In the examples, R^35CIndependently is-CCl₃. In factIn the examples, R^35CIndependently is-CBr₃. In the examples, R^35CIndependently is-CF₃. In the examples, R^35CIndependently is-CI₃. In the examples, R^35CIndependently is CHCl₂. In the examples, R^35CIndependently is-CHBr₂. In the examples, R^35CIndependently is-CHF₂. In the examples, R^35CIndependently is-CHI₂. In the examples, R^35CIndependently is-CH₂And (4) Cl. In the examples, R^35CIndependently is-CH₂Br is added. In the examples, R^35CIndependently is-CH₂F. In the examples, R^35CIndependently is-CH₂I. In the examples, R^35CIndependently is-CN. In the examples, R^35CIndependently is-OH. In the examples, R^35CIndependently is-NH₂. In the examples, R^35Cindependently-COOH. In the examples, R^35CIndependently is-CONH₂. In the examples, R^35CIndependently is-NO₂. In the examples, R^35CIndependently is-SH. In the examples, R^35CIndependently is-SO₃H. In the examples, R^35CIndependently is-SO₄H. In the examples, R^35CIndependently is-SO₂NH₂. In the examples, R^35CIndependently is-NHNH₂. In the examples, R^35CIndependently is-ONH₂. In the examples, R^35CIndependently is-NHC (O) NHNH₂. In the examples, R^35CIndependently is-NHC (O) NH₂. In the examples, R^35CIndependently is-NHSO₂H. In the examples, R^35Cindependently-NHC (O) H. In the examples, R^35Cindependently-NHC (O) OH. In the examples, R^35Cindependently-NHOH. In the examples, R^35CIndependently is-OCCl₃. In the examples, R^35CIndependently is-OCF₃. In the examples, R^35CIndependently is-OCBr₃. In the examples, R^35CIndependently is-OCI₃. In the examples, R^35CIndependently is-OCHCl₂. In the examples, R^35CIndependently is-OCHBr₂. In the examples, R^35CIndependently is-OCHI₂. In the examples, R^35CIndependently is-OCHF₂. In the examples, R^35CIndependently is-OCH₂And (4) Cl. In the examples, R^35CIndependently is-OCH₂Br is added. In the examples, R^35CIndependently is-OCH₂I. In the examples, R^35CIndependently is-OCH₂F。

R^36CIndependently oxo, halogen, -CCl₃、-CBr₃、-CF₃、-CI₃、CHCl₂、-CHBr₂、-CHF₂、-CHI₂、-CH₂Cl、-CH₂Br、-CH₂F、-CH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂、-NHC(O)NH₂、-NHSO₂H、-NHC(O)H、-NHC(O)OH、-NHOH、-OCCl₃、-OCF₃、-OCBr₃、-OCI₃、-OCHCl₂、-OCHBr₂、-OCHI₂、-OCHF₂、-OCH₂Cl、-OCH₂Br、-OCH₂I、-OCH₂F、-N₃Quilt R^37CSubstituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl), by R^37CSubstituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl), with R^37CSubstituted or unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl), by R^37CSubstituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl), with R^37CSubstituted or unsubstituted arylRadical (e.g. C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl) or by R^37CSubstituted or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl).

In the examples, R^6DIs hydrogen, halogen, CF₃、-CBr₃、-CCl₃、-CI₃、-CHF₂、-CHBr₂、-CHCl₂、-CHI₂、-CH₂F、-CH₂Br、-CH₂Cl、-CH₂I、-OCF₃、-OCBr₃、-OCCl₃、-OCI₃、-OCHF₂、-OCHBr₂、-OCHCl₂、-OCHI₂、-OCH₂F、-OCH₂Br、-OCH₂Cl、-OCH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂Quilt R^35DSubstituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl), by R^35DSubstituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl), with R^35DSubstituted or unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl), by R^35DSubstituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl), with R^35DSubstituted or unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl) or by R^35DSubstituted or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl).

In the examples, R^6DIs by R^35DSubstituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^6DIs by R^35DSubstituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^6DIs unsubstituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^6DIs by R^35DSubstituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R^6DIs by R^35DSubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R^6DIs unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R^6Dis-O- (substituted or unsubstituted C₁-C₈Alkyl groups). In the examples, R^6Dis-O- (substituted or unsubstituted C₁-C₆Alkyl groups). In the examples, R^6Dis-O- (substituted or unsubstituted C₁-C₄Alkyl groups). In the examples, R^6Dis-OCH₃. In the examples, R^6DIs by R^35DA substituted or unsubstituted 3-to 8-membered heterocycloalkyl group, wherein the heterocycloalkyl group contains an oxygen atom. In the examples, R^6DIs by R^35DA substituted or unsubstituted 5-to 6-membered heterocycloalkyl group, wherein the heterocycloalkyl group contains an oxygen atom. In the examples, R^6DIs by R^35DA substituted or unsubstituted 5-membered heterocycloalkyl group, wherein the heterocycloalkyl group comprises an oxygen atom. In the examples, R^6DIs by R^35DA substituted or unsubstituted 6-membered heterocycloalkyl group, wherein the heterocycloalkyl group comprises an oxygen atom.

In the examples, R^6DIs by R^35DSubstituted or unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups). In the examples, R^6DIs by R^35DSubstituted cycloalkyl groups (for example,C₃-C₈cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups). In the examples, R^6DIs unsubstituted cycloalkyl (e.g. C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups).

In the examples, R^6DIs by R^35DSubstituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl). In the examples, R^6DIs by R^35DSubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl). In the examples, R^6DIs unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl).

In the examples, R^6DIs by R^35DSubstituted or unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl). In the examples, R^6DIs by R^35DSubstituted aryl radicals (e.g. C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl). In the examples, R^6DIs unsubstituted aryl (e.g. C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl).

In the examples, R^6DIs by R^35DSubstituted or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl). In the examples, R^6DIs by R^35DSubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl). In the examples, R^6DIs unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl).

In the examples, R^6DThe method comprises the following steps:

in the examples, R^6DThe method comprises the following steps:in the examples, R^6DIs thatIn the examples, R^6DIs thatIn the examples, R^6DIs thatIn the examples, R^6DIs thatIn the examples, R^6DIs that

In the examples, R^6DIs that

In the examples, R^6DIs thatIn the examples, R^6DIs that

In the examples, R^6DIs that

In the examples, R^6DIs thatIn the examples, R^6DIs thatIn the examples, R^6DIs that

In the examples, R^6DIs thatIn the examples, R^6DIs that

In the examples, R^6DIs that

In the examples, R^6DIs thatIn the examples, R^6DIs thatIn the examples, R^6DIs that

In the examples, R^6DIs that

In the examples, R^6DIs thatIn the examples, R^6DIs thatIn the examples, R^6DIs that

In the examples, R^6DIs thatIn the examples, R^6DIs thatIn the examples, R^6DIs thatIn the examples，R^6DIs thatIn the examples, R^6DIs thatIn the examples, R^6DIs that

In the examples, R^6DIs thatIn the examples, R^6DIs that

In the examples, R^6DIs that

In the examples, R^6DIs thatIn the examples, R^6DIs that

In the examples, R^6DIs that

In the examples, R^6DIs thatIn the examples, R^6DIs thatIn the examples, R^6DIs thatIn the examples, R^6DIs thatIn the examples, R^6DIs thatIn the examples, R^6DIs thatIn the examples, R^6DIs thatIn the examples, R^6DIs thatIn the examples, R^6DIs that

In the examples, R^6DIs thatIn the examples, R^6DIs that

In the examples, R^6DIs thatIn the examples, R^6DIs thatIn the examples, R^6DIs thatIn the examples, R^6DIs thatIn the examples, R^6DIs that

R^35DIs oxo, halogen, -CCl₃、-CBr₃、-CF₃、-CI₃、CHCl₂、-CHBr₂、-CHF₂、-CHI₂、-CH₂Cl、-CH₂Br、-CH₂F、-CH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂、-NHC(O)NH₂、-NHSO₂H、-NHC(O)H、-NHC(O)OH、-NHOH、-OCCl₃、-OCF₃、-OCBr₃、-OCI₃、-OCHCl₂、-OCHBr₂、-OCHI₂、-OCHF₂、-OCH₂Cl、-OCH₂Br、-OCH₂I、-OCH₂F. Substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. In the examples, R^35DIndependently of one another, oxo, haloElement, -CCl₃、-CBr₃、-CF₃、-CI₃、CHCl₂、-CHBr₂、-CHF₂、-CHI₂、-CH₂Cl、-CH₂Br、-CH₂F、-CH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂、-NHC(O)NH₂、-NHSO₂H、-NHC(O)H、-NHC(O)OH、-NHOH、-OCCl₃、-OCF₃、-OCBr₃、-OCI₃、-OCHCl₂、-OCHBr₂、-OCHI₂、-OCHF₂、-OCH₂Cl、-OCH₂Br、-OCH₂I、-OCH₂F、-N₃Quilt R^36DSubstituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl), by R^36DSubstituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl), with R^36DSubstituted or unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl), by R^36DSubstituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl), with R^36DSubstituted or unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl) or by R^36DSubstituted or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl).

In the examples, R^35DIs unsubstituted phenyl. In the examples, R^35DIs unsubstituted methyl. In the examples, R^35Dis-CF₃. In the examples, R^35Dis-NH₂. In the examples, R^35DIs unsubstituted benzyl. In the examples, R^35DIs an oxo group. In the examples, R^35DIs a halogen. In the examples, R^35Dis-CCl₃. In the examples, R^35Dis-CBr₃. In the examples, R^35Dis-CF₃. In the examples, R^35Dis-CI₃. In the examples, R^35DIs CHCl₂. In the examples, R^35Dis-CHBr₂. In the examples, R^35Dis-CHF₂. In the examples, R^35Dis-CHI₂. In the examples, R^35Dis-CH₂And (4) Cl. In the examples, R^35Dis-CH₂Br is added. In the examples, R^35Dis-CH₂F. In the examples, R^35Dis-CH₂I. In the examples, R^35Dis-CN. In the examples, R^35Dis-OH. In the examples, R^35Dis-NH₂. In the examples, R^35Dis-COOH. In the examples, R^35Dis-CONH₂. In the examples, R^35Dis-NO₂. In the examples, R^35Dis-SH. In the examples, R^35Dis-SO₃H. In the examples, R^35Dis-SO₄H. In the examples, R^35Dis-SO₂NH₂. In the examples, R^35Dis-NHNH₂. In the examples, R^35Dis-ONH₂. In the examples, R^35Dis-NHC (O) NHNH₂. In the examples, R^35Dis-NHC (O) NH₂. In the examples, R^35Dis-NHSO₂H. In the examples, R^35Dis-NHC (O) H. In the examples, R^35Dis-NHC (O) OH. In the examples, R^35Dis-NHOH. In the examples, R^35Dis-OCCl₃. In the examples, R^35Dis-OCF₃. In the examples, R^35Dis-OCBr₃. In the examples, R^35Dis-OCI₃. In the examples, R^35Dis-OCHCl₂. In the examples, R^35Dis-OCHBr₂. In the examples, R^35Dis-OCHI₂. In the examples, R^35Dis-OCHF₂. In the examples, R^35Dis-OCH₂And (4) Cl. In the examples, R^35Dis-OCH₂Br is added. In the examples, R^35Dis-OCH₂I. In the examples, R^35Dis-OCH₂F。

R^36DIndependently oxo, halogen, -CCl₃、-CBr₃、-CF₃、-CI₃、CHCl₂、-CHBr₂、-CHF₂、-CHI₂、-CH₂Cl、-CH₂Br、-CH₂F、-CH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂、-NHC(O)NH₂、-NHSO₂H、-NHC(O)H、-NHC(O)OH、-NHOH、-OCCl₃、-OCF₃、-OCBr₃、-OCI₃、-OCHCl₂、-OCHBr₂、-OCHI₂、-OCHF₂、-OCH₂Cl、-OCH₂Br、-OCH₂I、-OCH₂F、-N₃Quilt R^37DSubstituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl), by R^37DSubstituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl), with R^37DSubstituted or unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl), by R^37DSubstituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl), with R^37DSubstituted or unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl) or by R^37DSubstituted or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl).

In the examples, R⁶Is that

Wherein R is³⁵And z16 as described herein (including the examples).

In the examples, R⁶Is that

Wherein R is³⁵And z16 as described herein (including the examples). In the examples, R⁶Is thatWherein R is³⁵And z16 as described herein (including the examples). In the examples, R⁶Is that

Wherein R is³⁵And z16 as described herein (including the examples). In the examples, R⁶Is that

Wherein R is³⁵And z16 as described herein (including the examples). In the examples, R⁶Is thatWherein R is³⁵And z16 as described herein (including the examples). In the examples, R⁶Is thatWherein R is³⁵And z16 as described herein (including the examples). In the examples, R⁶Is thatWherein R is³⁵And z16 as described herein (including the examples). In the examples, R⁶Is thatWherein R is³⁵And z16 as described herein (including the examples). In the examples, R⁶Is that

Wherein R is³⁵And z16 as described herein (including the examples). In the examples, R⁶Is that

Wherein R is³⁵And z16 as described herein (including the examples).

In the examples, R⁶Is that Wherein z16 is as described herein, including the examples. In the examples, R⁶Is that

In the examples, R⁶Is that

In the examples, R⁶Is thatIn the examples, R⁶Is that

In an embodiment, z16 is 1. In an embodiment, z16 is 2. In an embodiment, z16 is 3. In an embodiment, z16 is 4. In an embodiment, z16 is 5. In an embodiment, z16 is 6. In an embodiment, z16 is 7. In an embodiment, z16 is 8. In an embodiment, z16 is an integer from 1 to 3. In an embodiment, z16 is an integer from 1 to 2. In an embodiment, z16 is an integer from 1 to 4. In an embodiment, z16 is 0.

In the examples, R⁶Independently an unsubstituted methyl group. In the examples, R⁶Independently is unsubstituted C₁-C₃An alkyl group.

In the examples, R⁶Independently is-F. In the examples, R⁶Independently a halogen.

In the examples, R⁶Independently is-OCH₃. In the examples, R⁶Independently is-OCH₂CH₃. In the examples, R⁶Independently is-CH₂OCH₃. In the examples, R⁶Independently an unsubstituted 2-to 3-membered heteroalkyl group. In the examples, R⁶Independently is-OH.

In the examples, R⁶Independently is-CH₂And (5) OH. In the examples, R⁶Independently a substituted methyl group. In the examples, R⁶Independently is C substituted by OH₁-C₃An alkyl group. In the examples, R⁶Independently is substituted C₁-C₃An alkyl group.

In the examples, R⁶Independently an unsubstituted phenyl substituted propyl group. In the examples, R⁶Independently is unsubstituted phenyl-substituted C₂-C₆An alkyl group. In the examples, R⁶Independently is unsubstituted aryl substituted C₂-C₆An alkyl group.

In the examples, R⁶Independently is tert-butoxycarbonyl. In the examples, R⁶Independently a 6-membered heteroalkyl substituted with oxo. In the examples, R⁶Independently a 4 to 8 membered heteroalkyl substituted with oxo. In the examples, R⁶Is a substituted 6-membered heteroalkyl group. In the examples, R⁶Is a substituted 4-to 8-membered heteroalkyl group. In the examples, R⁶Independently, is tert-butyl carbamate.

In the examples, R⁶Independently tert-butyl carbamate substituted with N-methyl. In the examples, R⁶Independently a 6 to 10 membered heteroalkyl substituted with oxo. In the examples, R⁶Independently a substituted 6 to 10 membered heteroalkyl.

In the examples, R⁶Independently is-SO₂CH₃. In thatIn the examples, R⁶Independently is-SO₂- (unsubstituted C)₁-C₃Alkyl groups). In the examples, R⁶Independently a 2 to 4 membered heteroalkyl substituted with oxo.

In the examples, R⁶Independently is-CH₂CF₃. In the examples, R⁶Independently an ethyl group substituted with a halo group. In the examples, R⁶Independently is C substituted by halogen₁-C₄An alkyl group.

In the examples, R⁶Independently is-NHC (O) CH₃. In the examples, R⁶Independently a 2 to 4 membered heteroalkyl substituted with-oxo. In the examples, R⁶Independently is-CH₂NH₂。

In the examples, R⁶Independently is-NH (CH)₃). In the examples, R⁶Independently is-NR^6AR^6B. In the examples, R⁶Independently an unsubstituted 2-to 3-membered heteroalkyl group. In the examples, R⁶Independently is-NH₂。

In the examples, R⁶independently-COOH.

In the examples, R⁶Independently an 8-membered heteroalkyl substituted with oxo. In the examples, R⁶Independently a 6 to 10 membered heteroalkyl substituted with oxo. In the examples, R⁶Independently a substituted 8-membered heteroalkyl group. In the examples, R⁶Independently a substituted 6 to 10 membered heteroalkyl.

In the examples, R⁶Independently is-CH₂NH₂. In the examples, R⁶Independently by NH₂Substituted C₁-C₃An alkyl group.

In the examples, R⁶Independently is-OCH₂CH₃. In the examples, R⁶Independently an unsubstituted 2-to 4-membered alkoxy group. In the examples, R⁶Independently an unsubstituted 2-to 4-membered heteroalkyl group. In the examples, R⁶Independently an unsubstituted 2-to 4-membered heteroalkyl group.

In the examples, R⁶Independently unsubstituted benzyl carbamate. In the examples, R⁶Independently a 2 to 5 membered heteroalkyl substituted with OH and unsubstituted phenyl. In the examples, R⁶Independently a substituted 2-to 5-membered heteroalkyl group.

In the examples, R⁶Independently is-N (CH)₃)₂. In the examples, R⁶Independently is-N (unsubstituted C)₁-C₃Alkyl radical)₂. In the examples, R⁶Independently an unsubstituted 2-to 6-membered heteroalkyl group.

In the examples, R⁶Independently is-CH₂C(O)NHCH₂CH₃. In the examples, R⁶Independently a 4 to 6 membered heteroalkyl substituted with oxo. In the examples, R⁶Independently a substituted 4-to 6-membered heteroalkyl group.

In the examples, R⁶Independently is-CH₂N(CH₃)₂. In the examples, R⁶Independently an unsubstituted 2-to 6-membered heteroalkyl group.

In the examples, R⁶Independently is-C (O) NH₂. In the examples, R⁶Independently by oxo and by NH₂A substituted methyl group. In the examples, R⁶Independently by oxo and by NH₂Substituted C₁-C₄An alkyl group. In the examples, R⁶Independently is substituted C₁-C₄An alkyl group.

In the examples, R⁶Independently is-N (CH)₃)C(O)OCH₂CH₃. In the examples, R⁶Independently a 4 to 8 membered heteroalkyl substituted with oxo. In the examples, R⁶Independently a substituted 4-to 8-membered heteroalkyl group.

In the examples, R⁶Independently a 4 to 10 membered heteroalkyl substituted with oxo. In the examples, R⁶Independently a substituted 4-to 10-membered heteroalkyl group. In the examples, R⁶Independently by oxygenSubstituted 2 to 6 membered heteroalkyl. In the examples, R⁶Independently a substituted 2-to 6-membered heteroalkyl group. In the examples, R⁶Independently a 4 to 8 membered heteroalkyl substituted with oxo. In the examples, R⁶Independently a substituted 4-to 8-membered heteroalkyl group. In the examples, R⁶Independently a 3 to 8 membered heteroalkyl substituted with oxo and unsubstituted phenyl. In the examples, R⁶Independently a 3 to 8 membered heteroalkyl substituted with oxo and unsubstituted aryl. In the examples, R⁶Independently a 4 to 6 membered heteroalkyl substituted with oxo and unsubstituted aryl. In the examples, R⁶Independently a 4 to 6 membered heteroalkyl substituted with oxo and unsubstituted phenyl. In the examples, R⁶Independently a substituted 3-to 8-membered heteroalkyl group. In the examples, R⁶Independently a substituted 4-to 6-membered heteroalkyl group. In the examples, R⁶Independently an unsubstituted 2-to 4-membered heteroalkyl group.

R^6.1And R^6.2Each being hydrogen or R in a fixed position on the bonded ring⁶。R^6.1And R^6.2R may be as described herein (including any aspect, embodiment, example, figure, or technical scheme)⁶Any substituent of (1). R^6.1Independently hydrogen, halogen, -CX⁶ ₃、-CHX⁶ ₂、-CH₂X⁶、-OCX⁶ ₃、-OCH₂X⁶、-OCHX⁶ ₂、-CN、-SR^6D、-SO₂R^6D、-NR^6AR^6B、-C(O)R^6C、-C(O)OR^6C、-C(O)NR^6AR^6B、-OR^6D、-NR^6AC(O)R^6C-、-NR^6AC(O)NR^6C-、-NR^6AC(O)OR^6CSubstituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. R^6.2Independently of hydrogenHalogen, -CX⁶ ₃、-CHX⁶ ₂、-CH₂X⁶、-OCX⁶ ₃、-OCH₂X⁶、-OCHX⁶ ₂、-CN、-SR^6D、-SO₂R^6D、-NR^6AR^6B、-C(O)R^6C、-C(O)OR^6C、-C(O)NR^6AR^6B、-OR^6D、-NR^6AC(O)R^6C-、-NR^6AC(O)NR^6C-、-NR^6AC(O)OR^6CSubstituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.

In the examples, R^6.1Is a halogen. In the examples, R^6.1is-CX⁶ ₃. In the examples, R^6.1is-CHX⁶ ₂. In the examples, R^6.1is-CH₂X⁶. In the examples, R^6.1is-OCX⁶ ₃. In the examples, R^6.1is-OCH₂X⁶. In the examples, R^6.1is-OCHX⁶ ₂. In the examples, R^6.1is-CN. In the examples, R^6.1is-SR^6D. In the examples, R^6.1is-SO₂R^6D. In the examples, R^6.1is-NR^6AR^6B. In the examples, R^6.1is-C (O) R^6C. In the examples, R^6.1is-C (O) OR^6C. In the examples, R^6.1is-C (O) NR^6AR^6B. In the examples, R^6.1is-OR^6D. In the examples, R^6.1is-NR^6AC(O)R^6C. In the examples, R^6.1is-NR^6AC(O)OR^6C。

In the examples, R^6.1Is substituted or unsubstituted C₁-C₆Alkyl, substituted or unsubstituted 2-to 6-membered heteroalkyl, substituted or unsubstitutedSubstituted C₃-C₆Cycloalkyl, substituted or unsubstituted 3-to 6-membered heterocycloalkyl, substituted or unsubstituted phenyl, or substituted or unsubstituted 5-to 6-membered heteroaryl. In the examples, R^6.1Is hydrogen, substituted or unsubstituted C₁-C₈Alkyl or substituted or unsubstituted 2 to 8 membered heteroalkyl.

In the examples, R^6.1Independently of one another is halogen, -CX⁶ ₃、-CHX⁶ ₂、-CH₂X⁶、-OCX⁶ ₃、-OCH₂X⁶、-OCHX⁶ ₂、-CN、-SR^6D、-SO₂R^6D、-NR^6AR^6B、-C(O)R^6C、-C(O)OR^6C、-C(O)NR^6AR^6B、-OR^6D、-NR^6AC(O)R^6C、-NR^6AC(O)OR^6CSubstituted or unsubstituted alkyl or substituted or unsubstituted heteroalkyl.

In the examples, R^6.1Is by R³⁵Substituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^6.1Is by R³⁵Substituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^6.1Is unsubstituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^6.1Is by R³⁵Substituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R^6.1Is by R³⁵Substituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R^6.1Is unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl).

In the examples, R^6.1Is by R³⁵Substituted or unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups). In the examples, R^6.1Is by R³⁵Substituted cycloalkyl (e.g. C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups). In the examples, R^6.1Is unsubstituted cycloalkyl (e.g. C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups).

In the examples, R^6.1Is by R³⁵Substituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl). In the examples, R^6.1Is by R³⁵Substituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl). In the examples, R^6.1Is unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl).

In the examples, R^6.1Is by R³⁵Substituted or unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl). In the examples, R^6.1Is by R³⁵Substituted aryl radicals (e.g. C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl). In the examples, R^6.1Is unsubstituted aryl (e.g. C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl).

In the examples, R^6.1Is by R³⁵Substituted or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl). In the examples, R^6.1Is by R³⁵Substituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl). In the examples, R^6.1Is unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl).

In the examples, R^6.2Is a halogen. In the examples, R^6.2is-CX⁶ ₃. In the examples, R^6.2is-CHX⁶ ₂. In the examples, R^6.2is-CH₂X⁶. In the examples, R^6.2is-OCX⁶ ₃. In the examples, R^6.2is-OCH₂X⁶. In the examples, R^6.2is-OCHX⁶ ₂. In the examples, R^6.2is-CN. In the examples, R^6.2is-SR^6D. In the examples, R^6.2is-SO₂R^6D. In the examples, R^6.2is-NR^6AR^6B. In the examples, R^6.2is-C (O) R^6C. In the examples, R^6.2is-C (O) OR^6C. In the examples, R^6.2is-C (O) NR^6AR^6B. In the examples, R^6.2is-OR^6D. In the examples, R^6.2is-NR^6AC(O)R^6C. In the examples, R^6.2is-NR^6AC(O)OR^6C。

In the examples, R^6.2Is substituted or unsubstituted C₁-C₆Alkyl, substituted or unsubstituted 2-to 6-membered heteroalkyl, substituted or unsubstituted C₃-C₆Cycloalkyl, substituted or unsubstituted 3-to 6-membered heterocycloalkyl, substituted or unsubstituted phenyl, or substituted or unsubstituted 5-to 6-membered heteroaryl. In the examples, R^6.2Is hydrogen, substituted or unsubstituted C₁-C₈Alkyl or substituted or unsubstituted 2 to 8 membered heteroalkyl.

In the examples, R^6.2Independently of one another is halogen, -CX⁶ ₃、-CHX⁶ ₂、-CH₂X⁶、-OCX⁶ ₃、-OCH₂X⁶、-OCHX⁶ ₂、-CN、-SR^6D、-SO₂R^6D、-NR^6AR^6B、-C(O)R^6C、-C(O)OR^6C、-C(O)NR^6AR^6B、-OR^6D、-NR^6AC(O)R^6C、-NR^6AC(O)OR^6CSubstituted or unsubstituted alkyl or substituted or unsubstituted heteroalkyl.

In the examples, R^6.2Is by R³⁵Substituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^6.2Is by R³⁵Substituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^6.2Is unsubstituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^6.2Is by R³⁵Substituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R^6.2Is by R³⁵Substituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples, R^6.2Is unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl).

In the examples, R^6.2Is by R³⁵Substituted or unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups). In the examples, R^6.2Is by R³⁵Substituted cycloalkyl (e.g. C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups). In the examples, R^6.2Is unsubstituted cycloalkyl (e.g. C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups).

In the examples, R^6.2Is by R³⁵Substituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl or5-to 6-membered heterocycloalkyl). In the examples, R^6.2Is by R³⁵Substituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl). In the examples, R^6.2Is unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl).

In the examples, R^6.2Is by R³⁵Substituted or unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl). In the examples, R^6.2Is by R³⁵Substituted aryl radicals (e.g. C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl). In the examples, R^6.2Is unsubstituted aryl (e.g. C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl).

In the examples, R^6.2Is by R³⁵Substituted or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl). In the examples, R^6.2Is by R³⁵Substituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl). In the examples, R^6.2Is unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl).

In the examples, R^6.1Independently is-F. In the examples, R^6.1Independently a halogen. In the examples, R^6.1Independently is-OCH₃. In the examples, R^6.1Independently is-OCH₂CH₃. In the examples, R^6.1Independently is-CH₂OCH₃. In the examples, R^6.1Independently an unsubstituted 2-to 3-membered heteroalkyl group. In the examples, R^6.1Independently is-OH. In the examples, R^6.1Independently is-CH₂And (5) OH. In the examples, R^6.1Independently a substituted methyl group. In the examples, R^6.1Independently is C substituted by OH₁-C₃An alkyl group. In the examples, R^6.1Is independently a quiltSubstituted C₁-C₃An alkyl group. In the examples, R^6.1Independently an unsubstituted phenyl substituted propyl group. In the examples, R^6.1Independently is unsubstituted phenyl-substituted C₂-C₆An alkyl group. In the examples, R^6.1Independently is unsubstituted aryl substituted C₂-C₆An alkyl group. In the examples, R^6.1Independently is tert-butoxycarbonyl. In the examples, R^6.1Independently a 6-membered heteroalkyl substituted with oxo. In the examples, R^6.1Independently a 4 to 8 membered heteroalkyl substituted with oxo. In the examples, R^6.1Is a substituted 6-membered heteroalkyl group. In the examples, R^6.1Is a substituted 4-to 8-membered heteroalkyl group. In the examples, R^6.1Independently, is tert-butyl carbamate. In the examples, R^6.1Independently tert-butyl carbamate substituted with N-methyl. In the examples, R^6.1Independently a 6 to 10 membered heteroalkyl substituted with oxo. In the examples, R^6.1Independently a substituted 6 to 10 membered heteroalkyl. In the examples, R^6.1Independently is-SO₂CH₃. In the examples, R^6.1Independently is-SO₂- (unsubstituted C)₁-C₃Alkyl groups). In the examples, R^6.1Independently a 2 to 4 membered heteroalkyl substituted with oxo. In the examples, R^6.1Independently is-CH₂CF₃. In the examples, R^6.1Independently an ethyl group substituted with a halo group. In the examples, R^6.1Independently is C substituted by halogen₁-C₄An alkyl group. In the examples, R^6.1Independently is-NHC (O) CH₃. In the examples, R^6.1Independently a 2 to 4 membered heteroalkyl substituted with-oxo. In the examples, R^6.1Independently is-CH₂NH₂. In the examples, R^6.1Independently is-NH (CH)₃). In the examples, R^6.1Independently is-NR^6.1BR^6.1B. In the examples, R^6.1Independently an unsubstituted 2-to 3-membered heteroalkyl group. In the examples，R^6.1Independently is-NH₂. In the examples, R^6.1independently-COOH. In the examples, R^6.1Independently an 8-membered heteroalkyl substituted with oxo. In the examples, R^6.1Independently a 6 to 10 membered heteroalkyl substituted with oxo. In the examples, R^6.1Independently a substituted 8-membered heteroalkyl group. In the examples, R^6.1Independently a substituted 6 to 10 membered heteroalkyl. In the examples, R^6.1Independently is-CH₂NH₂. In the examples, R^6.1Independently by NH₂Substituted C₁-C₃An alkyl group. In the examples, R^6.1Independently is-OCH₂CH₃. In the examples, R^6.1Independently an unsubstituted 2-to 4-membered alkoxy group. In the examples, R^6.1Independently an unsubstituted 2-to 4-membered heteroalkyl group. In the examples, R^6.1Independently an unsubstituted 2-to 4-membered heteroalkyl group. In the examples, R^6.1Independently unsubstituted benzyl carbamate. In the examples, R^6.1Independently a 2 to 5 membered heteroalkyl substituted with OH and unsubstituted phenyl. In the examples, R^6.1Independently a substituted 2-to 5-membered heteroalkyl group. In the examples, R^6.1Independently is-N (CH)₃)₂. In the examples, R^6.1Independently is-N (unsubstituted C)₁-C₃Alkyl radical)₂. In the examples, R^6.1Independently an unsubstituted 2-to 6-membered heteroalkyl group. In the examples, R^6.1Independently is-CH₂C(O)NHCH₂CH₃. In the examples, R^6.1Independently a 4 to 6 membered heteroalkyl substituted with oxo. In the examples, R^6.1Independently a substituted 4-to 6-membered heteroalkyl group. In the examples, R^6.1Independently is-CH₂N(CH₃)₂. In the examples, R^6.1Independently an unsubstituted 2-to 6-membered heteroalkyl group. In the examples, R^6.1Independently is-C (O) NH₂. In the examples, R^6.1Independently by oxo and by NH₂A substituted methyl group. In the examples, R^6.1Independently by oxo and by NH₂Substituted C₁-C₄An alkyl group. In the examples, R^6.1Independently is substituted C₁-C₄An alkyl group. In the examples, R^6.1Independently is-N (CH)₃)C(O)OCH₂CH₃. In the examples, R^6.1Independently a 4 to 8 membered heteroalkyl substituted with oxo. In the examples, R^6.1Independently a substituted 4-to 8-membered heteroalkyl group. In the examples, R^6.1Independently a 4 to 10 membered heteroalkyl substituted with oxo. In the examples, R^6.1Independently a substituted 4-to 10-membered heteroalkyl group. In the examples, R^6.1Independently a 2 to 6 membered heteroalkyl substituted with oxo. In the examples, R^6.1Independently a substituted 2-to 6-membered heteroalkyl group. In the examples, R^6.1Independently a 4 to 8 membered heteroalkyl substituted with oxo. In the examples, R^6.1Independently a substituted 4-to 8-membered heteroalkyl group. In the examples, R^6.1Independently a 3 to 8 membered heteroalkyl substituted with oxo and unsubstituted phenyl. In the examples, R^6.1Independently a 3 to 8 membered heteroalkyl substituted with oxo and unsubstituted aryl. In the examples, R^6.1Independently a 4 to 6 membered heteroalkyl substituted with oxo and unsubstituted aryl. In the examples, R^6.1Independently a 4 to 6 membered heteroalkyl substituted with oxo and unsubstituted phenyl. In the examples, R^6.1Independently a substituted 3-to 8-membered heteroalkyl group. In the examples, R^6.1Independently a substituted 4-to 6-membered heteroalkyl group. In the examples, R^6.1Independently an unsubstituted 2-to 4-membered heteroalkyl group.

In the examples, R^6.2Independently is-F. In the examples, R^6.2Independently a halogen. In the examples, R^6.2Independently is-OCH₃. In the examples, R^6.2Independently is-OCH₂CH₃. In the examples, R^6.2Independently is-CH₂OCH₃. In the examples, R^6.2Independently an unsubstituted 2-to 3-membered heteroalkyl group. In the examples, R^6.2Independently is-OH. In the examples, R^6.2Independently is-CH₂And (5) OH. In the examples, R^6.2Independently a substituted methyl group. In the examples, R^6.2Independently is C substituted by OH₁-C₃An alkyl group. In the examples, R^6.2Independently is substituted C₁-C₃An alkyl group. In the examples, R^6.2Independently an unsubstituted phenyl substituted propyl group. In the examples, R^6.2Independently is unsubstituted phenyl-substituted C₂-C₆An alkyl group. In the examples, R^6.2Independently is unsubstituted aryl substituted C₂-C₆An alkyl group. In the examples, R^6.2Independently is tert-butoxycarbonyl. In the examples, R^6.2Independently a 6-membered heteroalkyl substituted with oxo. In the examples, R^6.2Independently a 4 to 8 membered heteroalkyl substituted with oxo. In the examples, R^6.2Is a substituted 6-membered heteroalkyl group. In the examples, R^6.2Is a substituted 4-to 8-membered heteroalkyl group. In the examples, R^6.2Independently, is tert-butyl carbamate. In the examples, R^6.2Independently tert-butyl carbamate substituted with N-methyl. In the examples, R^6.2Independently a 6 to 10 membered heteroalkyl substituted with oxo. In the examples, R^6.2Independently a substituted 6 to 10 membered heteroalkyl. In the examples, R^6.2Independently is-SO₂CH₃. In the examples, R^6.2Independently is-SO₂- (unsubstituted C)₁-C₃Alkyl groups). In the examples, R^6.2Independently a 2 to 4 membered heteroalkyl substituted with oxo. In the examples, R^6.2Independently is-CH₂CF₃. In the examples, R^6.2Independently an ethyl group substituted with a halo group. In the examples, R^6.2Independently is C substituted by halogen₁-C₄An alkyl group. In the examples, R^6.2Independently is-NHC (O) CH₃. In thatIn the examples, R^6.2Independently a 2 to 4 membered heteroalkyl substituted with-oxo. In the examples, R^6.2Independently is-CH₂NH₂. In the examples, R^6.2Independently is-NH (CH)₃). In the examples, R^6.2Independently is-NR^6.2BR^6.2B. In the examples, R^6.2Independently an unsubstituted 2-to 3-membered heteroalkyl group. In the examples, R^6.2Independently is-NH₂. In the examples, R^6.2independently-COOH. In the examples, R^6.2Independently an 8-membered heteroalkyl substituted with oxo. In the examples, R^6.2Independently a 6 to 10 membered heteroalkyl substituted with oxo. In the examples, R^6.2Independently a substituted 8-membered heteroalkyl group. In the examples, R^6.2Independently a substituted 6 to 10 membered heteroalkyl. In the examples, R^6.2Independently is-CH₂NH₂. In the examples, R^6.2Independently by NH₂Substituted C₁-C₃An alkyl group. In the examples, R^6.2Independently is-OCH₂CH₃. In the examples, R^6.2Independently an unsubstituted 2-to 4-membered alkoxy group. In the examples, R^6.2Independently an unsubstituted 2-to 4-membered heteroalkyl group. In the examples, R^6.2Independently an unsubstituted 2-to 4-membered heteroalkyl group. In the examples, R^6.2Independently unsubstituted benzyl carbamate. In the examples, R^6.2Independently a 2 to 5 membered heteroalkyl substituted with OH and unsubstituted phenyl. In the examples, R^6.2Independently a substituted 2-to 5-membered heteroalkyl group. In the examples, R^6.2Independently is-N (CH)₃)₂. In the examples, R^6.2Independently is-N (unsubstituted C)₁-C₃Alkyl radical)₂. In the examples, R^6.2Independently an unsubstituted 2-to 6-membered heteroalkyl group. In the examples, R^6.2Independently is-CH₂C(O)NHCH₂CH₃. In the examples, R^6.2Independently is a 4 to 6 membered heteroalkyl substituted with oxo. In the examples, R^6.2Independently a substituted 4-to 6-membered heteroalkyl group. In the examples, R^6.2Independently is-CH₂N(CH₃)₂. In the examples, R^6.2Independently an unsubstituted 2-to 6-membered heteroalkyl group. In the examples, R^6.2Independently is-C (O) NH₂. In the examples, R^6.2Independently by oxo and by NH₂A substituted methyl group. In the examples, R^6.2Independently by oxo and by NH₂Substituted C₁-C₄An alkyl group. In the examples, R^6.2Independently is substituted C₁-C₄An alkyl group. In the examples, R^6.2Independently is-N (CH)₃)C(O)OCH₂CH₃. In the examples, R^6.2Independently a 4 to 8 membered heteroalkyl substituted with oxo. In the examples, R^6.2Independently a substituted 4-to 8-membered heteroalkyl group. In the examples, R^6.2Independently a 4 to 10 membered heteroalkyl substituted with oxo. In the examples, R^6.2Independently a substituted 4-to 10-membered heteroalkyl group. In the examples, R^6.2Independently a 2 to 6 membered heteroalkyl substituted with oxo. In the examples, R^6.2Independently a substituted 2-to 6-membered heteroalkyl group. In the examples, R^6.2Independently a 4 to 8 membered heteroalkyl substituted with oxo. In the examples, R^6.2Independently a substituted 4-to 8-membered heteroalkyl group. In the examples, R^6.2Independently a 3 to 8 membered heteroalkyl substituted with oxo and unsubstituted phenyl. In the examples, R^6.2Independently a 3 to 8 membered heteroalkyl substituted with oxo and unsubstituted aryl. In the examples, R^6.2Independently a 4 to 6 membered heteroalkyl substituted with oxo and unsubstituted aryl. In the examples, R^6.2Independently a 4 to 6 membered heteroalkyl substituted with oxo and unsubstituted phenyl. In the examples, R^6.2Independently a substituted 3-to 8-membered heteroalkyl group. In the examples, R^6.2Independently a substituted 4-to 6-membered heteroalkyl group. In the examples, R^6.2Independently an unsubstituted 2-to 4-membered heteroalkyl group.

In the examples, L¹Is by R³⁸Substituted or unsubstituted alkylene (e.g. C)₁-C₈Alkylene radical, C₁-C₆Alkylene or C₁-C₄Alkylene) or by R³⁸Substituted or unsubstituted heteroalkylene groups (e.g., 2-to 8-membered heteroalkylene groups, 2-to 6-membered heteroalkylene groups, or 2-to 4-membered heteroalkylene groups). In the examples, L¹Is by R³⁸Substituted or unsubstituted C₁-C₆Alkylene or by R³⁸Substituted or unsubstituted 2-to 6-membered heteroalkylene. In the examples, L¹Is C substituted by methyl₁-C₆An alkylene group. In the examples, L¹Is C substituted by methyl₁-C₅An alkylene group. In the examples, L¹Is C substituted by methyl₁-C₄An alkylene group. In the examples, L¹Is C substituted by methyl₁-C₃An alkylene group. In the examples, L¹Is C substituted by methyl₁-C₂An alkylene group. In the examples, L¹Is methylene substituted by methyl. In the examples, L¹Is a bond. In the examples, L¹Is substituted or unsubstituted C₁-C₃Alkylene, substituted or unsubstituted 2 to 3 membered heteroalkylene. In the examples, L¹Is a bond. In the examples, L¹Is methylene substituted by methyl.

In the examples, L¹Is by R³⁸Substituted or unsubstituted alkylene (e.g. C)₁-C₈Alkylene radical, C₁-C₆Alkylene or C₁-C₄Alkylene). In the examples, L¹Is by R³⁸Substituted alkylene (e.g. C)₁-C₈Alkylene radical, C₁-C₆Alkylene or C₁-C₄Alkylene). In the examples, L¹Is unsubstituted alkylene (e.g. C)₁-C₈Alkylene radical, C₁-C₆Alkylene or C₁-C₄Alkylene).In the examples, L¹Is by R³⁸Substituted or unsubstituted heteroalkylene groups (e.g., 2-to 8-membered heteroalkylene groups, 2-to 6-membered heteroalkylene groups, or 2-to 4-membered heteroalkylene groups). In the examples, L¹Is by R³⁸Substituted heteroalkylene groups (e.g., 2-to 8-membered heteroalkylene groups, 2-to 6-membered heteroalkylene groups, or 2-to 4-membered heteroalkylene groups). In the examples, L¹Is unsubstituted heteroalkylene (e.g., 2-to 8-membered heteroalkylene, 2-to 6-membered heteroalkylene, or 2-to 4-membered heteroalkylene).

R³⁸Independently oxo, halogen, -CCl₃、-CBr₃、-CF₃、-CI₃、CHCl₂、-CHBr₂、-CHF₂、-CHI₂、-CH₂Cl、-CH₂Br、-CH₂F、-CH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂、-NHC(O)NH₂、-NHSO₂H、-NHC(O)H、-NHC(O)OH、-NHOH、-OCCl₃、-OCF₃、-OCBr₃、-OCI₃、-OCHCl₂、-OCHBr₂、-OCHI₂、-OCHF₂、-OCH₂Cl、-OCH₂Br、-OCH₂I、-OCH₂F、-N₃Quilt R³⁹Substituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl), by R³⁹Substituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl), with R³⁹Substituted or unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl), by R³⁹Substituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl), with R³⁹Substituted or unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl) Or by R³⁹Substituted or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl).

R³⁹Independently oxo, halogen, -CCl₃、-CBr₃、-CF₃、-CI₃、CHCl₂、-CHBr₂、-CHF₂、-CHI₂、-CH₂Cl、-CH₂Br、-CH₂F、-CH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂、-NHC(O)NH₂、-NHSO₂H、-NHC(O)H、-NHC(O)OH、-NHOH、-OCCl₃、-OCF₃、-OCBr₃、-OCI₃、-OCHCl₂、-OCHBr₂、-OCHI₂、-OCHF₂、-OCH₂Cl、-OCH₂Br、-OCH₂I、-OCH₂F、-N₃Quilt R⁴⁰Substituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl), by R⁴⁰Substituted or unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl), with R⁴⁰Substituted or unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl), by R⁴⁰Substituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl), with R⁴⁰Substituted or unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl) or by R⁴⁰Substituted or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl).

In the examples, R³⁹Is by R⁴⁰Substituted or unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R³⁹Is by R⁴⁰Substituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R³⁹Is unsubstituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups).

In the examples, L¹Is substituted or unsubstituted C₁-C₃An alkylene group. In the examples, L¹Is a substituted or unsubstituted methylene group. In the examples, L¹Is substituted or unsubstituted C₁-C₆Alkylene or substituted or unsubstituted 2-to 6-membered heteroalkylene. In the examples, L¹Is substituted or unsubstituted C₁-C₃Alkylene or substituted or unsubstituted 2-to 3-membered heteroalkylene.

In the examples, L¹is-CH (CH)₃) -. In the examples, L¹Is an unsubstituted ethyl group. In the examples, L¹Is unsubstituted C₁-C₃An alkylene group. In the examples, L¹Is an unsubstituted methylene group. In the examples, L¹Is unsubstituted C₂-C₃An alkylene group. In the examples, L¹is-CH (CH)₂CH₃) -. In the examples, L¹is-C (CH)₃)₂-. In the examples, L¹is-CH₂CH₂-

In the examples, L¹is-CH (CH)₂OCH₃) -. In the examples, L¹Is an unsubstituted 3-membered heteroalkyl-substituted methylene group. In the examples, L¹Is an unsubstituted 2-to 4-membered heteroalkyl-substituted methylene group. In the examples, L¹is-CH (CH)₂OH) -. In the examples, L¹Is ethylene substituted by OH. In the examples, L¹Is C substituted by OH₁-C₃An alkylene group. In the examples, L¹Is a substituted ethylene group. In an embodiment of the present invention,L¹is substituted C₁-C₃An alkylene group. In the examples, L¹Is that

In the examples, L¹Is that

In the examples, L²Is a bond, -S (O)₂-, -C (O) -, -C (O) NH-, -C (O) O-, -OC (O) -, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroarylene. In the examples, L²Is a bond. In the examples, L²is-S (O)₂-. In the examples, L²is-S (O)₂NH-. In the examples, L²is-NHS (O)₂-. In the examples, L²is-C (O) -. In the examples, L²is-C (O) NH-. In the examples, L²is-NHC (O) -. In the examples, L²is-NHC (O) NH-. In the examples, L²is-C (O) O-. In the examples, L²is-OC (O) -.

In the examples, L²Is a substituted or unsubstituted alkylene (e.g., C)₁-C₈Alkylene radical, C₁-C₆Alkylene or C₁-C₄Alkylene). In the examples, L²Is a substituted alkylene group (e.g. C)₁-C₈Alkylene radical, C₁-C₆Alkylene or C₁-C₄Alkylene). In the examples, L²Is unsubstituted alkylene (e.g. C)₁-C₈Alkylene radical, C₁-C₆Alkylene or C₁-C₄Alkylene). In the examples, L²Is a substituted or unsubstituted heteroalkylene group (e.g., 2-to 8-membered heteroalkylene, 2-to 6-membered heteroalkylene, or 2-to 4-membered heteroalkylene). In the examples, L²Is a substituted heteroalkylene group (e.g., a 2-to 8-membered heteroalkylene group, a 2-to 6-membered heteroalkylene group, or a 2-to 4-membered heteroalkylene group). In the examples, L²Is unsubstituted heteroalkylene (e.g., 2-to 8-membered heteroalkylene, 2-to 6-membered heteroalkylene, or 2-to 4-membered heteroalkylene). In the examples, L²Is substituted or unsubstituted C₁-C₆An alkylene group. In the examples, L²Is substituted or unsubstituted C₁-C₄An alkylene group. In the examples, L²Is substituted or unsubstituted C₁-C₃An alkylene group. In the examples, L²Is substituted or unsubstituted C₁-C₂An alkylene group.

In embodiments, ring A is C₆-C₁₀Aryl or 5 to 10 membered heteroaryl. In embodiments, ring A is C₆-C₁₀Aryl or 5 to 10 membered heteroaryl. In embodiments, ring A is C₆-C₁₀And (4) an aryl group. In embodiments, ring a is phenyl. In embodiments, ring a is naphthyl. In embodiments, ring a is a 5 to 10 membered heteroaryl. In embodiments, ring a is a 5-to 6-membered heteroaryl. In embodiments, ring a is thienyl. In embodiments, ring a is furyl. In embodiments, ring a is pyrrolyl. In embodiments, ring a is imidazolyl. In an embodiment, ring a is pyrazolyl. In the examples, ring A is oxazolyl. In the examples, ring A is isoxazolyl. In embodiments, ring a is thiazolyl. In embodiments, ring a is pyridyl. In embodiments, ring a is pyridyl. In embodiments, ring a is pyrazinyl. In embodiments, ring a is pyrimidinyl. In an embodiment, ring a is pyridazinyl. In embodiments, ring a is 1,2, 3-triazinyl. In embodiments, ring a is 1,2, 4-triazinyl. In embodiments, ring a is 1,3, 5-triazinyl.

When ring A is substituted (e.g., substituted C)₆-C₁₀Aryl), it is understood that z1 is not 0 (i.e., ring A is substituted with R)¹Substituted). In embodiments, ring a is substituted C₆-C₁₀Aryl or substituted 5-to 10-membered heteroaryl. In embodiments, ring a is substituted C₆-C₁₀Aryl radicalsOr substituted 5-to 10-membered heteroaryl. In embodiments, ring a is substituted C₆-C₁₀And (4) an aryl group. In embodiments, ring a is substituted phenyl. In embodiments, ring a is substituted naphthyl. In embodiments, ring a is a substituted 5-to 10-membered heteroaryl. In embodiments, ring a is a substituted 5-to 6-membered heteroaryl. In embodiments, ring a is a substituted thienyl group. In embodiments, ring a is a substituted furyl group. In embodiments, ring a is a substituted pyrrolyl. In embodiments, ring a is substituted imidazolyl. In embodiments, ring a is substituted pyrazolyl. In the examples, ring A is a substituted oxazolyl group. In embodiments, ring a is a substituted isoxazolyl. In embodiments, ring a is a substituted thiazolyl. In embodiments, ring a is substituted pyridyl. In embodiments, ring a is substituted pyridyl. In embodiments, ring a is a substituted pyrazinyl. In embodiments, ring a is substituted pyrimidinyl. In an embodiment, ring a is a substituted pyridazinyl group. In embodiments, ring a is a substituted 1,2, 3-triazinyl group. In embodiments, ring a is a substituted 1,2, 4-triazinyl group. In embodiments, ring a is a substituted 1,3, 5-triazinyl group.

In embodiments, ring a is unsubstituted C₆-C₁₀Aryl or unsubstituted 5-to 10-membered heteroaryl. In embodiments, ring a is unsubstituted C₆-C₁₀Aryl or unsubstituted 5-to 10-membered heteroaryl. In embodiments, ring a is unsubstituted C₆-C₁₀And (4) an aryl group. In embodiments, ring a is unsubstituted phenyl. In embodiments, ring a is unsubstituted naphthyl. In embodiments, ring a is an unsubstituted 5-to 10-membered heteroaryl. In embodiments, ring a is an unsubstituted 5-to 6-membered heteroaryl. In embodiments, ring a is unsubstituted thienyl. In embodiments, ring a is unsubstituted furanyl. In embodiments, ring a is unsubstituted pyrrolyl. In embodiments, ring a is unsubstituted imidazolyl. In embodiments, ring a is unsubstituted pyrazolyl. In the examples, ring A is an unsubstituted oxazolyl. In embodiments, ring a is an unsubstituted isoxazolyl. In thatIn embodiments, ring a is unsubstituted thiazolyl. In embodiments, ring a is unsubstituted pyridyl. In embodiments, ring a is unsubstituted pyridyl. In embodiments, ring a is unsubstituted pyrazinyl. In embodiments, ring a is unsubstituted pyrimidinyl. In an embodiment, ring a is unsubstituted pyridazinyl. In embodiments, ring a is unsubstituted 1,2, 3-triazinyl. In embodiments, ring a is unsubstituted 1,2, 4-triazinyl. In embodiments, ring a is unsubstituted 1,3, 5-triazinyl.

In the examples, ring A is substituted by one R¹And (4) substitution. In embodiments, ring a is substituted with two optionally different R¹And (4) substituent substitution. In embodiments, ring a is substituted with three optionally different R¹And (4) substituent substitution. In embodiments, ring a is substituted with four optionally different R¹And (4) substituent substitution. In embodiments, ring a is substituted with five optionally different R¹And (4) substituent substitution.

In embodiments, ring a is phenyl or 5-to 6-membered heteroaryl. In embodiments, ring a is phenyl. In embodiments, ring a is a 5-to 6-membered heteroaryl. In embodiments, ring a is a 5 membered heteroaryl. In embodiments, ring a is a 5 membered heteroaryl.

In embodiments, ring a is phenyl, pyridyl, pyrazolyl, imidazolyl, oxazolyl, isoxazolyl, thiazolyl, furyl, pyrrolyl, thienyl, pyrazinyl, pyridazinyl or pyrimidinyl. In embodiments, ring a is phenyl. In embodiments, ring a is pyridyl. In an embodiment, ring a is pyrazolyl. In embodiments, ring a is imidazolyl. In the examples, ring A is oxazolyl. In the examples, ring A is isoxazolyl. In embodiments, ring a is thiazolyl. In embodiments, ring a is furyl. In embodiments, ring a is pyrrolyl. In embodiments, ring a is thienyl. In embodiments, ring a is pyrazinyl. In an embodiment, ring a is pyridazinyl. In embodiments, ring a is pyrimidinyl. In embodiments, ring a is phenyl or pyridyl. In embodiments, ring a is pyridyl.

In embodiments, ring a is phenyl.

In embodiments, ring a is pyridin-3-yl. In embodiments, ring a is pyridyl. In embodiments, ring a is 6 membered heteroaryl. In embodiments, ring a is pyridin-2-yl. In embodiments, ring a is pyridin-4-yl.

In embodiments, ring a is pyrimidin-5-yl. In embodiments, ring a is pyrimidinyl.

In the examples, ring A is pyridazin-3-yl. In an embodiment, ring a is pyridazinyl.

In embodiments, ring a is pyrazin-2-yl. In embodiments, ring a is pyrazinyl.

In embodiments, ring a is imidazol-1-yl. In embodiments, ring a is imidazolyl. In embodiments, ring a is a 5 membered heteroaryl.

In the examples, - (Ring A) - (R)¹)_z1Is thatIn the examples, - (Ring A) - (R)¹)_z1Is thatIn the examples, - (Ring A) - (R)¹)_z1Is that

In the examples, - (Ring A) - (R)¹)_z1Is thatIn the examples, - (Ring A) - (R)¹)_z1Is that

In the examples, - (Ring A) - (R)¹)_z1Is thatIn the examples, - (Ring A) - (R)¹)_z1Is thatIn the examples, - (Ring A) - (R)¹)_z1Is thatIn the examples, - (Ring A) - (R)¹)_z1Is that

In the examples, - (Ring A) - (R)¹)_z1Is that

In the examples, - (Ring A) - (R)¹)_z1Is thatIn the examples, - (Ring A) - (R)¹)_z1Is thatIn the examples, - (Ring A) - (R)¹)_z1Is thatIn the examples, - (Ring A) - (R)¹)_z1Is that

In the examples, - (Ring A) - (R)¹)_z1Is that

In the examples, - (Ring A) - (R)¹)_z1Is thatIn the examples, - (Ring A) - (R)¹)_z1Is that

In the examples, - (Ring A) - (R)¹)_z1Is that

In the examples, - (Ring A) - (R)¹)_z1Is thatIn the examples, - (Ring A) - (R)¹)_z1Is that

In the examples, - (Ring A) - (R)¹)_z1Is that

In the examples, - (Ring A) - (R)¹)_z1Is thatIn the examples, - (Ring A) - (R)¹)_z1Is that

In the examples, - (Ring A) - (R)¹)_z1Is thatIn the examples, - (Ring A) - (R)¹)_z1Is thatIn the examples, - (Ring A) - (R)¹)_z1Is that

Wherein R is^1.2And R^1.3Each being R at a fixed position on the bonded ring¹。R^1.2And R^1.3Can independently be R as described herein (including any aspect, embodiment, example, drawing, or technical scheme)¹OfAnd (c) which substituents are defined herein. In the examples, - (Ring A) - (R)¹)_z1Is thatIn the examples, - (Ring A) - (R)¹)_z1Is thatIn the examples, - (Ring A) - (R)¹)_z1Is that

In the examples, - (Ring A) - (R)¹)_z1Is thatIn the examples, - (Ring A) - (R)¹)_z1Is that

In the examples, - (Ring A) - (R)¹)_z1Is thatWherein R is^1.2And R^1.4Each being R at a fixed position on the bonded ring¹。R^1.2And R^1.4Can independently be R as described herein (including any aspect, embodiment, example, drawing, or technical scheme)¹Any substituent of (1). In the examples, - (Ring A) - (R)¹)_z1Is that

In the embodiment, - (Ring A) -(R¹)_z1Is that

In the examples, - (Ring A) - (R)¹)_z1Is that

In the examples, - (Ring A) - (R)¹)_z1Is thatIn the examples, - (Ring A) - (R)¹)_z1Is that

In the examples, - (Ring A) - (R)¹)_z1Is that

In the examples, - (Ring A) - (R)¹)_z1Is thatIn the examples, - (Ring A) - (R)¹)_z1Is that

In the examples, - (Ring A) - (R)¹)_z1Is thatIn the examples, - (Ring A) - (R)¹)_z1Is thatIn the examples, - (Ring A) - (R)¹)_z1Is thatIn the examples, - (Ring A) - (R)¹)_z1Is that

In the examples, - (Ring A) - (R)¹)_z1Is thatIn the examples, - (Ring A) - (R)¹)_z1Is thatIn the examples, - (Ring A) - (R)¹)_z1Is thatIn the examples, - (Ring A) - (R)¹)_z1Is thatIn the examples, - (Ring A) - (R)¹)_z1Is thatIn the examples, - (Ring A) - (R)¹)_z1Is thatIn the examples, - (Ring A) - (R)¹)_z1Is thatIn the examples, - (Ring A) - (R)¹)_z1Is thatIn the examples, - (Ring A) - (R)¹)_z1Is thatIn the examples, - (Ring A) - (R)¹)_z1Is thatIn the examples, - (Ring A) - (R)¹)_z1Is thatIn the examples, - (Ring A) - (R)¹)_z1Is thatIn the examples, - (Ring A) - (R)¹)_z1Is thatIn the examples, - (Ring A) - (R)¹)_z1Is that

In the examples, - (Ring A) - (R)¹)_z1Is that

In embodiments, ring B is a 4-to 8-membered heterocycloalkyl. In embodiments, ring B is a 4-membered heterocycloalkyl. In embodiments, ring B is a 5-membered heterocycloalkyl. In embodiments, ring B is a 6-membered heterocycloalkyl. In embodiments, ring B is a 7-membered heterocycloalkyl. In embodiments, ring B is an 8 membered heteroA cycloalkyl group. In embodiments, ring B is a 4-to 6-membered heterocycloalkyl. In embodiments, ring B is azetidinyl. When ring B is substituted (e.g., substituted 4-to 8-membered heterocycloalkyl), it is understood that z6 is other than 0 (i.e., ring B is substituted with R)⁶Substituted ring B).

In embodiments, ring B is a substituted or unsubstituted heterocycloalkyl. In embodiments, ring B is a substituted heterocycloalkyl. In embodiments, ring B is unsubstituted heterocycloalkyl. In embodiments, ring B is a substituted or unsubstituted 3-to 10-membered heterocycloalkyl. In embodiments, ring B is a substituted 3-to 10-membered heterocycloalkyl. In embodiments, ring B is unsubstituted 3-to 10-membered heterocycloalkyl. In embodiments, ring B is substituted with R⁶Substituted or unsubstituted 5-to 10-membered heterocycloalkyl. In embodiments, ring B is substituted with R⁶Substituted 5 to 10 membered heterocycloalkyl. In embodiments, ring B is an unsubstituted 5-to 10-membered heterocycloalkyl.

In embodiments, ring B is a substituted or unsubstituted 3-membered heterocycloalkyl. In embodiments, ring B is a substituted or unsubstituted 4-membered heterocycloalkyl. In embodiments, ring B is a substituted or unsubstituted 5-membered heterocycloalkyl. In embodiments, ring B is a substituted or unsubstituted 6-membered heterocycloalkyl. In embodiments, ring B is a substituted 3-membered heterocycloalkyl. In embodiments, ring B is a substituted 4-membered heterocycloalkyl. In embodiments, ring B is a substituted 5-membered heterocycloalkyl. In embodiments, ring B is a substituted 6-membered heterocycloalkyl. In embodiments, ring B is unsubstituted 3-membered heterocycloalkyl. In embodiments, ring B is unsubstituted 4-membered heterocycloalkyl. In embodiments, ring B is an unsubstituted 5-membered heterocycloalkyl. In embodiments, ring B is unsubstituted 6-membered heterocycloalkyl.

In embodiments, ring B is substituted or unsubstituted aziridinyl, aziridinyl (azirinyl), azetidinyl, dihydroazetidinyl (dihydroazetyl), diazacyclobutanyl, azetidinyl, pyrrolidinyl, pyrrolinyl, pyrrolyl, pyrazolidinyl, imidazolinyl, pyrazolinyl, pyrazolyl, thiazolidinyl, thiazolyl, isothiazolyl, piperidinyl, piperazinyl, morpholinyl, oxazinyl, thiomorpholinyl, thiazinyl, decahydroquinolinyl, dihydroazepinyl, azepinyl, azepanyl, or azoctyl. In embodiments, ring B is a substituted aziridinyl, azetidinyl, dihydroazetidinyl, diazacyclobutanyl, azetidinyl, pyrrolidinyl, pyrrolinyl, pyrrolyl, pyrazolidinyl, imidazolidinyl, pyrazolinyl, pyrazolyl, thiazolidinyl, thiazolyl, isothiazolyl, piperidinyl, piperazinyl, morpholinyl, oxazinyl, thiomorpholinyl, thiazinyl, decahydroquinolinyl, dihydroazepinyl, azepanyl, or azocyclooctyl. In embodiments, ring B is unsubstituted aziridinyl, azetidinyl, dihydroazetidinyl, diazacyclobutanyl, azetidinyl, pyrrolidinyl, pyrrolinyl, pyrrolyl, pyrazolidinyl, imidazolidinyl, pyrazolinyl, pyrazolyl, thiazolidinyl, thiazolyl, isothiazolyl, piperidinyl, piperazinyl, morpholinyl, oxazinyl, thiomorpholinyl, thiazinyl, decahydroquinolinyl, dihydroazepinyl, azepanyl, or azocyclooctyl.

In the examples, ring B is substituted by one R⁶And (4) substitution. In embodiments, ring B is substituted with two optionally different R⁶And (4) substituent substitution. In embodiments, ring B is substituted with three optionally different R⁶And (4) substituent substitution. In embodiments, ring B is substituted with four optionally different R⁶And (4) substituent substitution. In embodiments, ring B is substituted with five optionally different R⁶And (4) substituent substitution. In embodiments, ring B is substituted with six optionally different R⁶And (4) substituent substitution. In embodiments, ring B is optionally substituted with seven optionally different R⁶And (4) substituent substitution. In embodiments, ring B is substituted with eight optionally different R⁶And (4) substituent substitution. In embodiments, ring B is substituted with nine optionally different R⁶And (4) substituent substitution. In embodiments, ring B is substituted with ten optionally different R⁶And (4) substituent substitution.

In embodiments, ring B is azetidinyl. In embodiments, ring B is a 4-membered heterocycloalkyl. In embodiments, ring B is a 3 to 5 membered heterocycloalkyl. In embodiments, ring B is a 3-to 6-membered heterocycloalkyl. In embodiments, ring B is pyrrolidinyl. In embodiments, ring B is a 5-membered heterocycloalkyl. In embodiments, ring B is a 4-to 6-membered heterocycloalkyl. In embodiments, ring B is morpholino. In embodiments, ring B is a 6-membered heterocycloalkyl. In embodiments, ring B is a 5-to 7-membered heterocycloalkyl. In an embodiment, ring B is a 2-oxa-6-azaspiro [3.3] heptyl group. In the examples, ring B is 2-oxa-6-azaspiro [3.3] hept-6-yl. In embodiments, ring B is a 7-membered heterocycloalkyl. In embodiments, ring B is a 6 to 8 membered heterocycloalkyl. In embodiments, ring B is a 7-membered spiroheterocycloalkyl. In embodiments, ring B is a 6 to 8 membered spiroheterocycloalkyl. In embodiments, ring B is piperidin-1-yl. In embodiments, ring B is piperidinyl. In embodiments, ring B is piperazin-1-yl. In embodiments, ring B is piperazinyl. In the examples, ring B is oxazolidin-3-yl. In embodiments, ring B is an oxazolinyl group. In embodiments, ring B is an imidazolidyl. In embodiments, ring B is a 1, 3-oxazacyclohexanyl group. In embodiments, ring B is an oxazacyclohexanyl group.

In the examples, - (Ring B) - (R)⁶)_z6Is that

In the examples, - (Ring B) - (R)⁶)_z6Is thatIn the examples, - (Ring B) - (R)⁶)_z6Is thatIn the examples, - (Ring B) - (R)⁶)_z6Is that

In the examples, - (Ring B) - (R)⁶)_z6Is thatIn the examples, - (Ring B) - (R)⁶)_z6Is that

In the examples, - (Ring B) - (R)⁶)_z6Is that

In the examples, - (Ring B) - (R)⁶)_z6Is thatIn the examples, - (Ring B) - (R)⁶)_z6Is thatIn the examples, - (Ring B) - (R)⁶)_z6Is thatIn the examples, - (Ring B) - (R)⁶)_z6Is that

In the examples, - (Ring B) - (R)⁶)_z6Is thatIn the examples, - (Ring B) - (R)⁶)_z6Is thatIn the examples, - (Ring B) - (R)⁶)_z6Is that

In the examples, - (Ring B) - (R)⁶)_z6Is thatIn the examples, - (Ring B) - (R)⁶)_z6Is thatIn factIn the examples, - (Ring B) - (R)⁶)_z6Is thatIn the examples, - (Ring B) - (R)⁶)_z6Is thatIn the examples, - (Ring B) - (R)⁶)_z6Is thatIn the examples, - (Ring B) - (R)⁶)_z6Is thatIn the examples, - (Ring B) - (R)⁶)_z6Is that

In the examples, - (Ring B) - (R)⁶)_z6Is that

In the examples, - (Ring B) - (R)⁶)_z6Is thatIn the examples, - (Ring B) - (R)⁶)_z6Is thatIn the examples, - (Ring B) - (R)⁶)_z6Is thatIn the examples, - (Ring B) - (R)⁶)_z6Is thatIn the examples, - (Ring B) - (R)⁶)_z6Is thatIn the examples, - (Ring B) - (R)⁶)_z6Is thatIn the examples, - (Ring B) - (R)⁶)_z6Is thatIn the examples, - (Ring B) - (R)⁶)_z6Is that

In the examples, - (Ring B) - (R)⁶)_z6Is that

In the examples, - (Ring B) - (R)⁶)_z6Is. In the examples, - (Ring B) - (R)⁶)_z6Is thatIn the examples, - (Ring B) - (R)⁶)_z6Is that

In the examples, - (Ring B) - (R)⁶)_z6Is that

In the examples, - (Ring B) - (R)⁶)_z6Is thatIn the examples, - (Ring B) - (R)⁶)_z6Is that

In the examples, - (Ring B) - (R)⁶)_z6Is thatIn the examples, - (Ring B) - (R)⁶)_z6Is thatIn the examples, - (Ring B) - (R)⁶)_z6Is that

In the examples, - (Ring B) - (R)⁶)_z6Is thatIn the examples, - (Ring B) - (R)⁶)_z6Is that

In the examples, - (Ring B) - (R)⁶)_z6Is thatIn the examples, - (Ring B) - (R)⁶)_z6Is thatIn the examples, - (Ring B) - (R)⁶)_z6Is that

In the examples, - (Ring B) - (R)⁶)_z6Is thatIn the examples, - (Ring B) - (R)⁶)_z6Is thatIn the examples, - (Ring B) - (R)⁶)_z6Is thatIn the examples, - (A)Ring B) - (R⁶)_z6Is that

In the examples, - (Ring B) - (R)⁶)_z6Is that

In the examples, - (Ring B) - (R)⁶)_z6Is thatIn the examples, - (Ring B) - (R)⁶)_z6Is that

In the examples, - (Ring B) - (R)⁶)_z6Is thatIn the examples, - (Ring B) - (R)⁶)_z6Is thatIn the examples, - (Ring B) - (R)⁶)_z6Is thatIn the examples, - (Ring B) - (R)⁶)_z6Is that

In the examples, - (Ring B) - (R)⁶)_z6Is that

In the examples, - (Ring B) - (R)⁶)_z6Is thatIn the examples, - (Ring B) - (R)⁶)_z6Is thatIn the examples, - (Ring B) - (R)⁶)_z6Is thatIn the examples, - (Ring B) - (R)⁶)_z6Is that

In the examples, - (Ring B) - (R)⁶)_z6Is that

In the examples, - (Ring B) - (R)⁶)_z6Is thatIn the examples, - (Ring B) - (R)⁶)_z6Is that

In the examples, - (Ring B) - (R)⁶)_z6Is that

In the examples, - (Ring B) - (R)⁶)_z6Is thatIn the examples, - (Ring B) - (R)⁶)_z6Is that

In the examples, - (Ring B) - (R)⁶)_z6Is thatIn the examples, - (Ring B) - (R)⁶)_z6Is thatIn the examples, - (Ring B) - (R)⁶)_z6Is thatIn the examples, - (Ring B) - (R)⁶)_z6Is that

In the examples, - (Ring B) - (R)⁶)_z6Is thatIn the examples, - (Ring B) - (R)⁶)_z6Is thatIn the examples, - (Ring B) - (R)⁶)_z6Is that

In the examples, - (Ring B) - (R)⁶)_z6Is thatIn an embodiment, ring B is

In embodiments, ring C is substituted or unsubstituted C₃-C₆Cycloalkyl, substituted or unsubstituted 3-to 6-membered heterocycloalkyl, substituted or unsubstituted phenyl, or substituted or unsubstituted 5-to 6-membered heteroaryl. In embodiments, ring C is a substituted or unsubstituted 5-to 6-membered heteroaryl. When ring C is substituted (e.g., substituted C₃-C₆Cycloalkyl), it is understood that z24 is not 0 (i.e., ring C is substituted with R)²⁴Substituted).

In embodiments, ring C is substituted or unsubstituted cycloalkyl. In embodiments, ring C is a substituted or unsubstituted heterocycloalkyl. In embodiments, ring C is substituted or unsubstituted aryl. In embodiments, ring C is substituted or unsubstituted heteroaryl. In embodiments, ring C is substituted or unsubstituted (C)₃-C₁₀) Cycloalkyl, substituted or unsubstituted 3-to 10-membered heterocycloalkyl, substituted or unsubstituted (C)₆-C₁₀) Aryl or substituted or unsubstituted 5 to 10 membered heteroaryl. In embodiments, ring C is substituted or unsubstituted (C)₃-C₁₀) A cycloalkyl group. In embodiments, ring C is a substituted or unsubstituted 3-to 10-membered heterocycloalkyl. In embodiments, ring C is substituted or unsubstituted (C)₆-C₁₀) And (4) an aryl group. In embodiments, ring C is a substituted or unsubstituted 5-to 10-membered heteroaryl. In embodiments, ring C is substituted or unsubstituted (C)₃-C₆) A cycloalkyl group. In embodiments, ring C is a substituted or unsubstituted 3-to 6-membered heterocycloalkyl. In an embodiment, ring C is takenSubstituted or unsubstituted phenyl. In embodiments, ring C is substituted or unsubstituted naphthyl. In embodiments, ring C is a substituted or unsubstituted 5-to 9-membered heteroaryl. In embodiments, ring C is a substituted or unsubstituted 5-to 6-membered heteroaryl. In embodiments, ring C is an unsubstituted 5-to 6-membered heteroaryl. In embodiments, ring C is a substituted or unsubstituted 5-membered heteroaryl. In embodiments, ring C is a substituted 5-membered heteroaryl. In embodiments, ring C is an unsubstituted 5-membered heteroaryl.

In embodiments, ring C is substituted with R²⁴Substituted or unsubstituted (C)₃-C₁₀) Cycloalkyl radicals, by R²⁴Substituted or unsubstituted 5-to 10-membered heterocycloalkyl, substituted or unsubstituted by R²⁴Substituted or unsubstituted (C)₆-C₁₀) Aryl or by R²⁴Substituted or unsubstituted 5-to 10-membered heteroaryl. In embodiments, ring C is substituted with R²⁴Substituted or unsubstituted (C)₃-C₁₀) Cycloalkyl radicals or by R²⁴Substituted or unsubstituted 5-to 10-membered heterocycloalkyl. In embodiments, ring C is substituted with R²⁴Substituted or unsubstituted (C)₃-C₁₀) A cycloalkyl group. In embodiments, ring C is substituted with R²⁴Substituted or unsubstituted 3 to 10 membered heterocycloalkyl. In embodiments, ring C is substituted with R²⁴Substituted or unsubstituted (C)₆-C₁₀) And (4) an aryl group. In embodiments, ring C is substituted with R²⁴Substituted or unsubstituted 5-to 10-membered heteroaryl. In embodiments, ring C is substituted with R²⁴Substituted or unsubstituted (C)₃-C₆) A cycloalkyl group. In embodiments, ring C is substituted with R²⁴Substituted or unsubstituted 3-to 6-membered heterocycloalkyl. In embodiments, ring C is substituted with R²⁴Substituted or unsubstituted phenyl. In embodiments, ring C is substituted with R²⁴Substituted or unsubstituted naphthyl. In embodiments, ring C is substituted with R²⁴Substituted or unsubstituted 5-to 9-membered heteroaryl. In embodiments, ring C is substituted with R²⁴Substituted or unsubstituted 5-to 6-membered heteroaryl.

In embodiments, ring C is substituted with R²⁴Substituted or unsubstituted thienyl. In embodiments, ring C is substituted with R²⁴Substituted or unsubstituted phenyl. In embodiments, ring C is substituted with R²⁴Substituted or unsubstituted benzothienyl. In embodiments, ring C is substituted with R²⁴Substituted or unsubstituted naphthyl. In embodiments, ring C is substituted with R²⁴Substituted or unsubstituted benzofuranyl. In embodiments, ring C is substituted with R²⁴Substituted or unsubstituted furyl. In embodiments, ring C is substituted with R²⁴Substituted or unsubstituted pyrrolyl. In embodiments, ring C is substituted with R²⁴Substituted or unsubstituted oxazolyl. In embodiments, ring C is substituted with R²⁴Substituted or unsubstituted oxadiazolyl group. In embodiments, ring C is substituted with R²⁴A substituted or unsubstituted triazolyl. In embodiments, ring C is substituted with R²⁴Substituted or unsubstituted thiazolyl.

In embodiments, ring C is substituted cycloalkyl. In embodiments, ring C is a substituted heterocycloalkyl. In embodiments, ring C is substituted aryl. In embodiments, ring C is substituted heteroaryl. In embodiments, ring C is substituted (C)₃-C₁₀) Cycloalkyl, substituted 3-to 10-membered heterocycloalkyl, substituted (C)₆-C₁₀) Aryl or substituted 5-to 10-membered heteroaryl. In embodiments, ring C is substituted (C)₃-C₁₀) A cycloalkyl group. In embodiments, ring C is a substituted 3-to 10-membered heterocycloalkyl. In embodiments, ring C is substituted (C)₆-C₁₀) And (4) an aryl group. In embodiments, ring C is a substituted 5-to 10-membered heteroaryl. In embodiments, ring C is substituted (C)₃-C₆) A cycloalkyl group. In embodiments, ring C is a substituted 3-to 6-membered heterocycloalkyl. In embodiments, ring C is substituted phenyl. In embodiments, ring C is substituted naphthyl. In embodiments, ring C is a substituted 5-to 9-membered heteroaryl. In embodiments, ring C is a substituted 5-to 6-membered heteroaryl. In embodiments, ring C is substituted with R²⁴Substituted (C)₃-C₁₀) Cycloalkyl radicals, by R²⁴Substituted 5-to 10-membered heterocycloalkyl, by R²⁴Substituted (C)₆-C₁₀) Aryl or by R²⁴Substituted 5 to 10A membered heteroaryl group. In embodiments, ring C is substituted with R²⁴Substituted (C)₃-C₁₀) Cycloalkyl radicals or by R²⁴Substituted 5 to 10 membered heterocycloalkyl. In embodiments, ring C is substituted with R²⁴Substituted (C)₃-C₁₀) A cycloalkyl group. In embodiments, ring C is substituted with R²⁴Substituted 3 to 10 membered heterocycloalkyl. In embodiments, ring C is substituted with R²⁴Substituted (C)₆-C₁₀) And (4) an aryl group. In embodiments, ring C is substituted with R²⁴Substituted 5 to 10 membered heteroaryl. In embodiments, ring C is substituted with R²⁴Substituted (C)₃-C₆) A cycloalkyl group. In embodiments, ring C is substituted with R²⁴Substituted 3 to 6 membered heterocycloalkyl. In embodiments, ring C is substituted with R²⁴A substituted phenyl group. In embodiments, ring C is substituted with R²⁴Substituted naphthyl. In embodiments, ring C is substituted with R²⁴Substituted 5 to 9 membered heteroaryl. In embodiments, ring C is substituted with R²⁴Substituted 5 to 6 membered heteroaryl. In embodiments, ring C is substituted with R²⁴Substituted thienyl. In embodiments, ring C is substituted with R²⁴A substituted phenyl group. In embodiments, ring C is substituted with R²⁴Substituted benzothienyl. In embodiments, ring C is substituted with R²⁴Substituted naphthyl. In embodiments, ring C is substituted with R²⁴Substituted benzofuranyl. In embodiments, ring C is substituted with R²⁴A substituted furyl group. In embodiments, ring C is substituted with R²⁴A substituted pyrrolyl group. In embodiments, ring C is substituted with R²⁴Substituted oxazolyl. In embodiments, ring C is substituted with R²⁴Substituted oxadiazolyl groups. In embodiments, ring C is substituted with R²⁴A substituted triazolyl group. In embodiments, ring C is substituted with R²⁴A substituted thiazolyl group.

In embodiments, ring C is unsubstituted cycloalkyl. In embodiments, ring C is unsubstituted heterocycloalkyl. In embodiments, ring C is unsubstituted aryl. In embodiments, ring C is unsubstituted heteroaryl. In embodiments, ring C is unsubstituted (C)₃-C₁₀) Cycloalkyl, unsubstituted 3-to 10-membered heterocycloalkyl, unsubstituted (C)₆-C₁₀) Aryl radicals or unsubstitutedThe 5 to 10 membered heteroaryl of (a). In embodiments, ring C is unsubstituted (C)₃-C₁₀) A cycloalkyl group. In embodiments, ring C is unsubstituted 3-to 10-membered heterocycloalkyl. In embodiments, ring C is unsubstituted (C)₆-C₁₀) And (4) an aryl group. In embodiments, ring C is an unsubstituted 5-to 10-membered heteroaryl. In embodiments, ring C is unsubstituted (C)₃-C₆) A cycloalkyl group. In embodiments, ring C is unsubstituted 3-to 6-membered heterocycloalkyl. In embodiments, ring C is unsubstituted phenyl. In embodiments, ring C is unsubstituted naphthyl. In embodiments, ring C is an unsubstituted 5-to 9-membered heteroaryl. In embodiments, ring C is an unsubstituted 5-to 6-membered heteroaryl. In embodiments, ring C is unsubstituted (C)₃-C₁₀) Cycloalkyl, unsubstituted 5-to 10-membered heterocycloalkyl, unsubstituted (C)₆-C₁₀) Aryl or unsubstituted 5-to 10-membered heteroaryl. In embodiments, ring C is unsubstituted (C)₃-C₁₀) Cycloalkyl or unsubstituted 5-to 10-membered heterocycloalkyl. In embodiments, ring C is unsubstituted (C)₃-C₁₀) A cycloalkyl group. In embodiments, ring C is unsubstituted 3-to 10-membered heterocycloalkyl. In embodiments, ring C is unsubstituted (C)₆-C₁₀) And (4) an aryl group. In embodiments, ring C is an unsubstituted 5-to 10-membered heteroaryl. In embodiments, ring C is unsubstituted (C)₃-C₆) A cycloalkyl group. In embodiments, ring C is unsubstituted 3-to 6-membered heterocycloalkyl. In embodiments, ring C is unsubstituted phenyl. In embodiments, ring C is unsubstituted naphthyl. In embodiments, ring C is an unsubstituted 5-to 9-membered heteroaryl. In embodiments, ring C is an unsubstituted 5-to 6-membered heteroaryl. In embodiments, ring C is unsubstituted thienyl. In embodiments, ring C is unsubstituted phenyl. In embodiments, ring C is unsubstituted benzothienyl. In embodiments, ring C is unsubstituted naphthyl. In embodiments, ring C is unsubstituted benzofuranyl. In embodiments, ring C is unsubstituted furanyl. In embodiments, ring C is unsubstituted pyrrolyl. In embodiments, ring C is notA substituted oxazolyl group. In embodiments, ring C is unsubstituted phenyl. In embodiments, ring C is unsubstituted oxadiazolyl. In embodiments, ring C is an unsubstituted triazolyl. In embodiments, ring C is unsubstituted thiazolyl.

In embodiments, ring C is C₆-C₁₀Aryl or 5 to 10 membered heteroaryl. In embodiments, ring C is C₆-C₁₀Aryl or 5 to 10 membered heteroaryl. In embodiments, ring C is C₆-C₁₀And (4) an aryl group. In embodiments, ring C is phenyl. In embodiments, ring C is naphthyl. In embodiments, ring C is a 5 to 10 membered heteroaryl. In embodiments, ring C is a 5-to 6-membered heteroaryl. In embodiments, ring C is thienyl. In embodiments, ring C is furyl. In embodiments, ring C is pyrrolyl. In embodiments, ring C is imidazolyl. In an embodiment, ring C is pyrazolyl. In the examples, ring C is oxazolyl. In embodiments, ring C is isoxazolyl. In embodiments, ring C is thiazolyl. In embodiments, ring C is pyridyl. In embodiments, ring C is pyridyl. In embodiments, ring C is pyrazinyl. In embodiments, ring C is pyrimidinyl. In an embodiment, ring C is pyridazinyl. In embodiments, ring C is 1,2, 3-triazinyl. In embodiments, ring C is 1,2, 4-triazinyl. In embodiments, ring C is 1,3, 5-triazinyl.

In embodiments, ring C is substituted C₆-C₁₀Aryl or substituted 5-to 10-membered heteroaryl. In embodiments, ring C is substituted C₆-C₁₀Aryl or substituted 5-to 10-membered heteroaryl. In embodiments, ring C is substituted C₆-C₁₀And (4) an aryl group. In embodiments, ring C is substituted phenyl. In embodiments, ring C is substituted naphthyl. In embodiments, ring C is a substituted 5-to 10-membered heteroaryl. In embodiments, ring C is a substituted 5-to 6-membered heteroaryl. In embodiments, ring C is a substituted thienyl group. In embodiments, ring C is a substituted furyl group. In embodiments, ring C is a substituted pyrrolyl. In embodiments, ring C is substituted imidazolyl. In embodiments, ring C is substituted pyrazolyl. In factIn the examples, ring C is a substituted oxazolyl group. In embodiments, ring C is a substituted isoxazolyl. In embodiments, ring C is a substituted thiazolyl. In embodiments, ring C is substituted pyridyl. In embodiments, ring C is substituted pyridyl. In embodiments, ring C is a substituted pyrazinyl. In embodiments, ring C is substituted pyrimidinyl. In an embodiment, ring C is a substituted pyridazinyl group. In embodiments, ring C is a substituted 1,2, 3-triazinyl group. In embodiments, ring C is a substituted 1,2, 4-triazinyl group. In embodiments, ring C is a substituted 1,3, 5-triazinyl group.

In embodiments, ring C is unsubstituted C₆-C₁₀Aryl or unsubstituted 5-to 10-membered heteroaryl. In embodiments, ring C is unsubstituted C₆-C₁₀Aryl or unsubstituted 5-to 10-membered heteroaryl. In embodiments, ring C is unsubstituted C₆-C₁₀And (4) an aryl group. In embodiments, ring C is unsubstituted phenyl. In embodiments, ring C is unsubstituted naphthyl. In embodiments, ring C is an unsubstituted 5-to 10-membered heteroaryl. In embodiments, ring C is an unsubstituted 5-to 6-membered heteroaryl. In embodiments, ring C is unsubstituted thienyl. In embodiments, ring C is unsubstituted furanyl. In embodiments, ring C is unsubstituted pyrrolyl. In embodiments, ring C is unsubstituted imidazolyl. In embodiments, ring C is unsubstituted pyrazolyl. In embodiments, ring C is an unsubstituted oxazolyl. In embodiments, ring C is an unsubstituted isoxazolyl. In embodiments, ring C is unsubstituted thiazolyl. In embodiments, ring C is unsubstituted pyridyl. In embodiments, ring C is unsubstituted pyridyl. In embodiments, ring C is unsubstituted pyrazinyl. In embodiments, ring C is unsubstituted pyrimidinyl. In an embodiment, ring C is unsubstituted pyridazinyl. In embodiments, ring C is unsubstituted 1,2, 3-triazinyl. In embodiments, ring C is unsubstituted 1,2, 4-triazinyl. In embodiments, ring C is unsubstituted 1,3, 5-triazinyl.

In embodiments, ring C is a 4 to 8 membered heterocycloalkyl. In embodiments, ring C is a 4-membered heterocycloalkyl. In embodiments, ring C is a 5-membered heterocycloalkyl. In embodiments, ring C is a 6-membered heterocycloalkyl. In embodiments, ring C is a 7-membered heterocycloalkyl. In embodiments, ring C is an 8-membered heterocycloalkyl. In embodiments, ring C is a 4 to 6 membered heterocycloalkyl. In embodiments, ring C is azetidinyl.

In embodiments, ring C is a substituted or unsubstituted heterocycloalkyl. In embodiments, ring C is a substituted heterocycloalkyl. In embodiments, ring C is unsubstituted heterocycloalkyl. In embodiments, ring C is a substituted or unsubstituted 3-to 10-membered heterocycloalkyl. In embodiments, ring C is a substituted 3-to 10-membered heterocycloalkyl. In embodiments, ring C is unsubstituted 3-to 10-membered heterocycloalkyl. In embodiments, ring C is substituted with R⁶Substituted or unsubstituted 5-to 10-membered heterocycloalkyl. In embodiments, ring C is substituted with R⁶Substituted 5 to 10 membered heterocycloalkyl. In embodiments, ring C is an unsubstituted 5-to 10-membered heterocycloalkyl.

In embodiments, ring C is a substituted or unsubstituted 3-membered heterocycloalkyl. In embodiments, ring C is a substituted or unsubstituted 4-membered heterocycloalkyl. In embodiments, ring C is a substituted or unsubstituted 5-membered heterocycloalkyl. In embodiments, ring C is a substituted or unsubstituted 6-membered heterocycloalkyl. In embodiments, ring C is a substituted 3-membered heterocycloalkyl. In embodiments, ring C is a substituted 4-membered heterocycloalkyl. In embodiments, ring C is a substituted 5-membered heterocycloalkyl. In embodiments, ring C is a substituted 6-membered heterocycloalkyl. In embodiments, ring C is unsubstituted 3-membered heterocycloalkyl. In embodiments, ring C is unsubstituted 4-membered heterocycloalkyl. In embodiments, ring C is an unsubstituted 5-membered heterocycloalkyl. In embodiments, ring C is unsubstituted 6-membered heterocycloalkyl.

In embodiments, ring C is substituted or unsubstituted aziridinyl, azetidinyl, dihydroazetidinyl, diazacyclobutanyl, azetidinyl, pyrrolidinyl, pyrrolinyl, pyrrolyl, pyrazolidinyl, imidazolinyl, pyrazolinyl, pyrazolyl, thiazolidinyl, thiazolyl, isothiazolyl, piperidinyl, piperazinyl, morpholinyl, oxazinyl, thiomorpholinyl, thiazinyl, decahydroquinolinyl, dihydroazepinyl, azepanyl, or azocyclooctyl. In embodiments, ring C is a substituted aziridinyl, azetidinyl, dihydroazetidinyl, diazacyclobutanyl, azetidinyl, pyrrolidinyl, pyrrolinyl, pyrrolyl, pyrazolidinyl, imidazolidinyl, pyrazolinyl, pyrazolyl, thiazolidinyl, thiazolyl, isothiazolyl, piperidinyl, piperazinyl, morpholinyl, oxazinyl, thiomorpholinyl, thiazinyl, decahydroquinolinyl, dihydroazepinyl, azepanyl, or azocyclooctyl. In embodiments, ring C is unsubstituted aziridinyl, azetidinyl, dihydroazetidinyl, diazacyclobutanyl, azetidinyl, pyrrolidinyl, pyrrolinyl, pyrrolyl, pyrazolidinyl, imidazolidinyl, pyrazolinyl, pyrazolyl, thiazolidinyl, thiazolyl, isothiazolyl, piperidinyl, piperazinyl, morpholinyl, oxazinyl, thiomorpholinyl, thiazinyl, decahydroquinolinyl, dihydroazepinyl, azepanyl, or azocyclooctyl.

Ring C may be substituted by one R²⁴And (4) substitution. Ring C may be substituted by two optionally different R²⁴And (4) substituent substitution. Ring C may be substituted by three optionally different R²⁴And (4) substituent substitution. Ring C may be substituted by four optionally different R²⁴And (4) substituent substitution. Ring C may be substituted by five optionally different R²⁴And (4) substituent substitution. Ring C may be substituted by six optionally different R²⁴And (4) substituent substitution. Ring C may be optionally substituted with seven optionally different R²⁴And (4) substituent substitution. Ring C may be substituted by eight optionally different R²⁴And (4) substituent substitution. Ring C may be substituted by nine optionally different R²⁴And (4) substituent substitution. Ring C may be optionally substituted by ten R²⁴And (4) substituent substitution.

In embodiments, ring C is a substituted cyclopropyl. In embodiments, ring C is a substituted cyclobutyl. In embodiments, ring C is a substituted cyclohexyl. In embodiments, ring C is a substituted cyclopentyl. In an embodiment, ring C is OH substituted cyclopentyl. In embodiments, ring C is cyclobutyl substituted by OH. In embodiments, ring C is an unsubstituted cyclobutyl. In embodiments, ring C is unsubstituted cyclohexyl. In embodiments, ring C is an unsubstituted cyclopentyl. In embodiments, ring C is phenyl substituted with OH. In embodiments, ring C is substituted phenyl. In embodiments, ring C is unsubstituted phenyl. In embodiments, ring C is unsubstituted tetrahydropyranyl. In embodiments, ring C is a substituted tetrahydropyranyl. In embodiments, ring C is unsubstituted tetrahydrofuranyl. In embodiments, ring C is substituted tetrahydrofuranyl. In embodiments, ring C is unsubstituted cyclopropyl. In embodiments, ring C is unsubstituted pyridyl. In embodiments, ring C is substituted pyridyl. In embodiments, ring C is-OCH₃A substituted pyridyl group. In embodiments, ring C is substituted piperidinyl. In embodiments, ring C is unsubstituted piperidinyl. In embodiments, ring C is a substituted thiazolyl. In embodiments, ring C is unsubstituted thiazolyl. In embodiments, ring C is substituted pyrrolidinyl. In embodiments, ring C is unsubstituted pyrrolidinyl. In embodiments, ring C is a substituted oxetanyl group. In embodiments, ring C is unsubstituted oxetanyl. In embodiments, ring C is a substituted azetidinyl. In embodiments, ring C is unsubstituted azetidinyl. In embodiments, ring C is a substituted morpholinyl. In embodiments, ring C is unsubstituted morpholinyl. In embodiments, ring C is substituted imidazolyl. In embodiments, ring C is unsubstituted imidazolyl. In embodiments, ring C is substituted pyrimidinyl. In embodiments, ring C is unsubstituted pyrimidinyl. In an embodiment, ring C is a substituted pyridazinyl group. In an embodiment, ring C is unsubstituted pyridazinyl.

In the examples, each R^1A、R^1B、R^1C、R^1D、R^4A、R^4B、R^4C、R^4D、R^5A、R^5B、R^5C、R^5D、R^6A、R^6B、R^6CAnd R^6DIndependently of each other is hydrogen, halogen, CF₃、-CBr₃、-CCl₃、-CI₃、-CHF₂、-CHBr₂、-CHCl₂、-CHI₂、-CH₂F、-CH₂Br、-CH₂Cl、-CH₂I、-OCF₃、-OCBr₃、-OCCl₃、-OCI₃、-OCHF₂、-OCHBr₂、-OCHCl₂、-OCHI₂、-OCH₂F、-OCH₂Br、-OCH₂Cl、-OCH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂、-NHC(O)NH₂、-NHSO₂H. -NHC (O) H, -NHC (O) OH, -NHOH, unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl), unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl), unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl), unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl), unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl) or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl).

In the examples, R^1AIs hydrogen. In the examples, R^1BIs hydrogen. In the examples, R^1CIs hydrogen. In the examples, R^1DIs hydrogen. In the examples, R^4AIs hydrogen. In the examples, R^4BIs hydrogen. In the examples, R^4CIs hydrogen. In the examples, R^4DIs hydrogen. In the examples, R^5AIs hydrogen. In the examples, R^5BIs hydrogen. In the examples, R^5CIs hydrogen. In the examples, R^5DIs hydrogen. In the examples, R^1AIs a halogen. In the examples, R^1BIs a halogen. In the examples, R^1CIs a halogen. In the examples, R^1DIs a halogen. In the examples, R^ABIs a halogen. In the examples, R^4BIs a halogen. In the examples, R^4CIs a halogen. In the examples, R^4DIs a halogen. In the examples, R^5AIs a halogen. In the examples, R^5BIs a halogen. In the examples, R^5CIs a halogen. In the examples, R^5DIs a halogen. In the examples, R^6AIs a halogen. In the examples, R^6BIs a halogen. In the examples, R^6CIs a halogen. In the examples, R^6DIs a halogen.

In the examples, R^1AIs unsubstituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^1BIs unsubstituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^1CIs unsubstituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^1DIs unsubstituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^4AIs unsubstituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^4BIs unsubstituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^4CIs unsubstituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^4DIs unsubstituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^5AIs unsubstituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^5BIs unsubstituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^5CIs unsubstituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^5DIs unsubstituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^6AIs unsubstituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^6BIs unsubstituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^6CIs unsubstituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R^6DIs unsubstituted alkyl (e.g. C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups).

In the examples R^1AIs unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples R^1BIs unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples R^1CIs unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples R^1DIs unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples R^4AIs unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples R^4BIs unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples R^4CIs unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples R^4DIs unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples R^5AIs unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples R^5BIs unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples R^5CIs unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples R^5DIs unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples R^6AIs unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples R^6BIs unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples R^6CIs unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl). In the examples R^6DIs unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl).

In the examples, R bonded to the same nitrogen atom^1AAnd R^1BSubstituents may optionally join to form a substituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl). In the examples, R bonded to the same nitrogen atom^4AAnd R^4BSubstituents may optionally join to form a substituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl). In the examples, the same asR bound to a nitrogen atom^5AAnd R^5BSubstituents may optionally join to form a substituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl). In the examples, R bonded to the same nitrogen atom^6AAnd R^6BSubstituents may optionally join to form a substituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl). In the examples, R bonded to the same nitrogen atom^1AAnd R^1BSubstituents may optionally join to form substituted heterocycloalkyl groups (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl). In the examples, R bonded to the same nitrogen atom^4AAnd R^4BSubstituents may optionally join to form substituted heterocycloalkyl groups (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl). In the examples, R bonded to the same nitrogen atom^5AAnd R^5BSubstituents may optionally join to form substituted heterocycloalkyl groups (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl). In the examples, R bonded to the same nitrogen atom^6AAnd R^6BSubstituents may optionally join to form substituted heterocycloalkyl groups (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl). In the examples, R bonded to the same nitrogen atom^1AAnd R^1BSubstituents may optionally join to form unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl). In the examples, R bonded to the same nitrogen atom^4AAnd R^4BSubstituents may optionally join to form unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl). In the examples, R bonded to the same nitrogen atom^5AAnd R^5BSubstituents may optionally join to form unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl). In the examples, R bonded to the same nitrogen atom^6AAnd R^6BThe substituent can be anyOptionally joined to form an unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl).

In the examples, each R^1A、R^1B、R^1C、R^1D、R^4A、R^4B、R^4C、R^4D、R^5A、R^5B、R^5CAnd R^5DIndependently hydrogen, halogen, -CF₃、-CBr₃、-CCl₃、-CI₃、-CHF₂、-CHBr₂、-CHCl₂、-CHI₂、-CH₂F、-CH₂Br、-CH₂Cl、-CH₂I、-OCF₃、-OCBr₃、-OCCl₃、-OCI₃、-OCHF₂、-OCHBr₂、-OCHCl₂、-OCHI₂、-OCH₂F、-OCH₂Br、-OCH₂Cl、-OCH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂、-NHC(O)NH₂、-NHSO₂H. -NHC (O) H, -NHC (O) OH, -NHOH, unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl), unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl), unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl), unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl), unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl) or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl).

R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently an oxo group,Halogen, -CF₃、-CBr₃、-CCl₃、-CI₃、-CHF₂、-CHBr₂、-CHCl₂、-CHI₂、-CH₂F、-CH₂Br、-CH₂Cl、-CH₂I、-OCF₃、-OCBr₃、-OCCl₃、-OCI₃、-OCHF₂、-OCHBr₂、-OCHCl₂、-OCHI₂、-OCH₂F、-OCH₂Br、-OCH₂Cl、-OCH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂、-NHC(O)NH₂、-NHSO₂H、-NHC(O)H、-NHC(O)OH、-NHOH、-OCCl₃、-OCF₃、-OCBr₃、-OCI₃、-OCHCl₂、-OCHBr₂、-OCHI₂、-OCHF₂Unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl), unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl, 2-to 6-membered heteroalkyl, or 2-to 4-membered heteroalkyl), unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl), unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl), unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl) or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl).

In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently an oxo group. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently a halogen. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is-CF₃. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is-CBr₃. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is-CCl₃. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is-CI₃. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is-CHF₂. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is-CHBr₂. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is-CHCl₂. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is-CHI₂. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is-CH₂F. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is-CH₂Br is added. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is-CH₂And (4) Cl. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is-CH₂I. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is-OCF₃. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is-OCBr₃. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is-OCCl₃. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is-OCI₃. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is-OCHF₂. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is-OCHBr₂. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is-OCHCl₂. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is-OCHI₂. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is-OCH₂F. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is-OCH₂Br is added. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is-OCH₂And (4) Cl. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is-OCH₂I. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is-CN. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is-OH. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is-NH₂. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰independently-COOH. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is-CONH₂. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is-NO₂. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is-SH. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is-SO₃H. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is-SO₄H. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is-SO₂NH₂. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is-NHNH₂. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is-ONH₂、-NHC(O)NHNH₂. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is-NHC (O) NH₂. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is-NHSO₂H. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰independently-NHC (O) H. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰independently-NHC (O) OH. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰independently-NHOH. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is-OCCl₃. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is-OCF₃. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is-OCBr₃. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is-OCI₃. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is-OCHCl₂. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is-OCHBr₂. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is-OCHI₂. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is-OCHF₂. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl groups). In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently an unsubstituted heteroalkyl group (e.g., a 2-to 8-membered heteroalkyl group, a 2-to 6-membered heteroalkyl group, or a 2-to 4-membered heteroalkyl group). In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups). In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently an unsubstituted heterocycloalkyl group (e.g., a 3-to 8-membered heterocycloalkyl group, a 3-to 6-membered heterocycloalkyl group, or a 5-to 6-membered heterocycloalkyl group). In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl). In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl). In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is-CH₃. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is unsubstituted C₂An alkyl group. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is unsubstituted C₃An alkyl group. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is unsubstituted C₄An alkyl group. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is unsubstituted C₅An alkyl group. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is unsubstituted C₆An alkyl group. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is unsubstituted C₇An alkyl group. In the examples, R²²、R²⁵、R²⁸、R³¹、R³⁴、R³⁷And R⁴⁰Independently is unsubstituted C₈An alkyl group.

R^37A、R^37B、R^37CAnd R^37DIndependently oxo, halogen, -CF₃、-CBr₃、-CCl₃、-CI₃、-CHF₂、-CHBr₂、-CHCl₂、-CHI₂、-CH₂F、-CH₂Br、-CH₂Cl、-CH₂I、-OCF₃、-OCBr₃、-OCCl₃、-OCI₃、-OCHF₂、-OCHBr₂、-OCHCl₂、-OCHI₂、-OCH₂F、-OCH₂Br、-OCH₂Cl、-OCH₂I、-CN、-OH、-NH₂、-COOH、-CONH₂、-NO₂、-SH、-SO₃H、-SO₄H、-SO₂NH₂、-NHNH₂、-ONH₂、-NHC(O)NHNH₂、-NHC(O)NH₂、-NHSO₂H、-NHC(O)H、-NHC(O)OH、-NHOH、-OCCl₃、-OCF₃、-OCBr₃、-OCI₃、-OCHCl₂、-OCHBr₂、-OCHI₂、-OCHF₂Unsubstituted alkyl (e.g., C)₁-C₈Alkyl radical, C₁-C₆Alkyl or C₁-C₄Alkyl), unsubstituted heteroalkyl (e.g., 2-to 8-membered heteroalkyl)6-membered heteroalkyl or 2-to 4-membered heteroalkyl), unsubstituted cycloalkyl (e.g., C)₃-C₈Cycloalkyl radical, C₃-C₆{86 cycloalkyl or C₅-C₆Cycloalkyl), unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl), unsubstituted aryl (e.g., C)₆-C₁₀Aryl radical, C₁₀Aryl, or phenyl) or unsubstituted heteroaryl (e.g., 5-to 10-membered heteroaryl, 5-to 9-membered heteroaryl, or 5-to 6-membered heteroaryl).

In the examples, R²⁵is-OH. In the examples, R²⁵is-OCH₃. In the examples, R²⁵is-OCH₂CH₃. In the examples, R²⁵is-F. In the examples, R²⁵is-NHC (O) CH₃. In the examples, R²⁵is-COOH. In the examples, R²⁵is-SO₂NH₂。

In the examples, R²⁸is-OH. In the examples, R²⁸is-OCH₃. In the examples, R²⁸is-OCH₂CH₃. In the examples, R²⁸is-F. In the examples, R²⁸is-NHC (O) CH₃. In the examples, R²⁸is-COOH. In the examples, R²⁸is-SO₂NH₂。

In the examples, X¹is-F. In the examples, X¹is-Cl. In the examples, X¹is-Br. In the examples, X¹is-I. In the examples, X⁴is-F. In the examples, X⁴is-Cl. In the examples, X⁴is-Br. In the examples, X⁴is-I. In the examples, X⁵is-F. In the examples, X⁵is-Cl. In the examples, X⁵is-Br. In the examples, X⁵is-I. In the examples, X⁶is-F. In the examples, X⁶is-Cl. In the examples, X⁶is-Br. In the examples, X⁶is-I.

In an embodiment, z1 is an integer from 0 to 5. In an embodiment, z1 is an integer from 0 to 2. In an embodiment, z1 is 0. In an embodiment, z1 is 1. In an embodiment, z1 is 2. In an embodiment, z1 is 3. In an embodiment, z1 is 4. In an embodiment, z1 is 5. In an embodiment, z6 is an integer from 0 to 5. In an embodiment, z6 is an integer from 0 to 2. In an embodiment, z6 is 0. In an embodiment, z6 is 1. In an embodiment, z6 is 2. In an embodiment, z6 is 3. In an embodiment, z6 is 4. In an embodiment, z6 is 5. In an embodiment, z6 is 6. In an embodiment, z6 is 7. In an embodiment, z6 is 8. In an embodiment, z6 is 9. In an embodiment, z6 is 10. In an embodiment, z16 is 1. In an embodiment, z16 is 2. In an embodiment, z16 is 3. In an embodiment, z16 is 4. In an embodiment, z16 is 5. In an embodiment, z16 is 6. In an embodiment, z16 is 7. In an embodiment, z16 is 8. In an embodiment, z24 is 0. In an embodiment, z24 is 1. In an embodiment, z24 is 2. In an embodiment, z24 is 3. In an embodiment, z24 is 4. In an embodiment, z24 is 5. In an embodiment, z24 is 6. In an embodiment, z24 is 7. In an embodiment, z24 is 8. In an embodiment, z24 is 9. In an embodiment, z24 is 10.

In an embodiment, the compound is Z1. In an embodiment, the compound is Z2. In an embodiment, the compound is Z3. In an embodiment, the compound is Z4. In an embodiment, the compound is Z5. In an embodiment, the compound is Z6. In an embodiment, the compound is Z7. In an embodiment, the compound is Z8. In an embodiment, the compound is Z9. In an embodiment, the compound is Z10. In an embodiment, the compound is Z11. In an embodiment, the compound is Z12. In an embodiment, the compound is Z13. In an embodiment, the compound is Z14. In an embodiment, the compound is Z15. In an embodiment, the compound is Z16. In an embodiment, the compound is Z17. In an embodiment, the compound is Z18. In an embodiment, the compound is Z19. In an embodiment, the compound is Z20. In an embodiment, the compound is Z21. In an embodiment, the compound is Z22. In an embodiment, the compound is Z23. In an embodiment, the compound is Z24. In an embodiment, the compound is Z25. In an embodiment, the compound is Z26. In an embodiment, the compound is Z27. In an embodiment, the compound is Z28. In an embodiment, the compound is Z29. In an embodiment, the compound is Z30. In an embodiment, the compound is Z31. In an embodiment, the compound is Z32. In an embodiment, the compound is Z33. In an embodiment, the compound is Z34. In an embodiment, the compound is Z35. In an embodiment, the compound is Z36. In an embodiment, the compound is Z37. In an embodiment, the compound is Z38. In an embodiment, the compound is Z39. In an embodiment, the compound is Z40. In an embodiment, the compound is Z41. In an embodiment, the compound is Z42. In an embodiment, the compound is Z43. In an embodiment, the compound is Z44. In an embodiment, the compound is Z45. In an embodiment, the compound is Z46. In an embodiment, the compound is Z47. In an embodiment, the compound is Z48. In an embodiment, the compound is Z49. In an embodiment, the compound is Z50. In an embodiment, the compound is Z51. In an embodiment, the compound is Z52. In an embodiment, the compound is Z53. In an embodiment, the compound is Z54. In an embodiment, the compound is Z55. In an embodiment, the compound is Z56. In an embodiment, the compound is Z57. In an embodiment, the compound is Z58. In an embodiment, the compound is Z59. In an embodiment, the compound is Z60. In an embodiment, the compound is Z61. In an embodiment, the compound is Z62. In an embodiment, the compound is Z63. In an embodiment, the compound is Z64. In an embodiment, the compound is Z65. In an embodiment, the compound is Z66. In an embodiment, the compound is Z67. In an embodiment, the compound is Z68. In an embodiment, the compound is Z69. In an embodiment, the compound is Z70. In an embodiment, the compound is Z71. In an embodiment, the compound is Z72. In an embodiment, the compound is Z73. In an embodiment, the compound is Z74. In an embodiment, the compound is Z75. In an embodiment, the compound is Z76. In an embodiment, the compound is Z77. In an embodiment, the compound is Z78. In an embodiment, the compound is Z79. In an embodiment, the compound is Z80. In an embodiment, the compound is Z81. In an embodiment, the compound is Z82. In an embodiment, the compound is Z83. In an embodiment, the compound is Z84. In an embodiment, the compound is Z85. In an embodiment, the compound is Z86. In an embodiment, the compound is Z87. In an embodiment, the compound is Z88. In an embodiment, the compound is Z89. In an embodiment, the compound is Z90. In an embodiment, the compound is Z91. In an embodiment, the compound is Z92. In an embodiment, the compound is Z93. In an embodiment, the compound is Z94. In an embodiment, the compound is Z95. In an embodiment, the compound is Z96. In an embodiment, the compound is Z97. In an embodiment, the compound is Z98. In an embodiment, the compound is Z99. In an embodiment, the compound is Z100. In an embodiment, the compound is Z101. In an embodiment, the compound is Z102. In an embodiment, the compound is Z103. In an embodiment, the compound is Z104. In an embodiment, the compound is Z105. In an embodiment, the compound is Z106. In an embodiment, the compound is Z107. In an embodiment, the compound is Z108. In an embodiment, the compound is Z109. In an embodiment, the compound is Z110. In an embodiment, the compound is Z111. In an embodiment, the compound is Z112. In an embodiment, the compound is Z113. In an embodiment, the compound is Z114. In an embodiment, the compound is Z115. In an embodiment, the compound is Z116. In an embodiment, the compound is Z117. In an embodiment, the compound is Z118. In an embodiment, the compound is Z119. In an embodiment, the compound is Z120. In an embodiment, the compound is Z121. In an embodiment, the compound is Z122. In an embodiment, the compound is Z123. In an embodiment, the compound is Z124. In an embodiment, the compound is Z125. In an embodiment, the compound is Z126. In an embodiment, the compound is Z127. In an embodiment, the compound is Z128. In an embodiment, the compound is Z129. In an embodiment, the compound is Z130. In an embodiment, the compound is Z131. In an embodiment, the compound is Z132. In an embodiment, the compound is Z133. In an embodiment, the compound is Z134. In an embodiment, the compound is Z135. In an embodiment, the compound is Z136. In an embodiment, the compound is Z137. In an embodiment, the compound is Z138. In an embodiment, the compound is Z139. In an embodiment, the compound is Z140. In an embodiment, the compound is Z141. In an embodiment, the compound is Z142. In an embodiment, the compound is Z143. In an embodiment, the compound is Z144. In an embodiment, the compound is Z145. In an embodiment, the compound is Z146. In an embodiment, the compound is Z147. In an embodiment, the compound is Z148. In an embodiment, the compound is Z149. In an embodiment, the compound is Z150. In an embodiment, the compound is Z151. In an embodiment, the compound is Z152. In an embodiment, the compound is Z153. In an embodiment, the compound is Z154. In an embodiment, the compound is Z155. In an embodiment, the compound is Z156. In an embodiment, the compound is Z157. In an embodiment, the compound is Z158. In an embodiment, the compound is Z159. In an embodiment, the compound is Z160. In an embodiment, the compound is Z161. In an embodiment, the compound is Z162. In an embodiment, the compound is Z163. In an embodiment, the compound is Z164. In an embodiment, the compound is Z165. In an embodiment, the compound is Z166. In an embodiment, the compound is Z167. In an embodiment, the compound is Z168. In an embodiment, the compound is Z169. In an embodiment, the compound is Z170. In an embodiment, the compound is Z171. In an embodiment, the compound is Z172. In an embodiment, the compound is Z173. In an embodiment, the compound is Z174. In an embodiment, the compound is Z175. In an embodiment, the compound is Z176. In an embodiment, the compound is Z177. In an embodiment, the compound is Z178. In an embodiment, the compound is Z179. In an embodiment, the compound is Z180. In an embodiment, the compound is Z181. In an embodiment, the compound is Z182. In an embodiment, the compound is Z183. In an embodiment, the compound is Z184. In an embodiment, the compound is Z185. In an embodiment, the compound is Z186. In an embodiment, the compound is Z187. In an embodiment, the compound is Z188. In an embodiment, the compound is Z189. In an embodiment, the compound is Z190. In an embodiment, the compound is Z191. In an embodiment, the compound is Z192. In an embodiment, the compound is Z193. In an embodiment, the compound is Z194. In an embodiment, the compound is Z195. In an embodiment, the compound is Z196. In an embodiment, the compound is Z197. In an embodiment, the compound is Z198. In an embodiment, the compound is Z199. In an embodiment, the compound is Z200. In an embodiment, the compound is Z201. In an embodiment, the compound is Z202. In an embodiment, the compound is Z203. In an embodiment, the compound is Z204. In an embodiment, the compound is Z205. In an embodiment, the compound is Z206. In an embodiment, the compound is Z207. In an embodiment, the compound is Z208. In an embodiment, the compound is Z209. In an embodiment, the compound is Z210. In an embodiment, the compound is Z211. In an embodiment, the compound is Z212. In an embodiment, the compound is Z213. In an embodiment, the compound is Z214. In an embodiment, the compound is Z215. In an embodiment, the compound is Z216. In an embodiment, the compound is Z217. In an embodiment, the compound is Z218. In an embodiment, the compound is Z219. In an embodiment, the compound is Z220. In an embodiment, the compound is Z221. In an embodiment, the compound is Z222. In an embodiment, the compound is Z223. In an embodiment, the compound is Z224. In an embodiment, the compound is Z225. In an embodiment, the compound is Z226. In an embodiment, the compound is Z227. In an embodiment, the compound is Z228. In an embodiment, the compound is Z229. In an embodiment, the compound is Z230. In an embodiment, the compound is Z231. In an embodiment, the compound is Z232. In an embodiment, the compound is Z233. In an embodiment, the compound is Z234. In an embodiment, the compound is Z235. In an embodiment, the compound is Z236. In an embodiment, the compound is Z237. In an embodiment, the compound is Z238. In an embodiment, the compound is Z239. In an embodiment, the compound is Z240. In an embodiment, the compound is Z241. In an embodiment, the compound is Z242. In an embodiment, the compound is Z243. In an embodiment, the compound is Z244. In an embodiment, the compound is Z245. In an embodiment, the compound is Z246. In an embodiment, the compound is Z247. In an embodiment, the compound is Z248. In an embodiment, the compound is Z249. In an embodiment, the compound is Z250. In an embodiment, the compound is Z251. In an embodiment, the compound is Z252. In an embodiment, the compound is Z253. In an embodiment, the compound is Z254. In an embodiment, the compound is Z255. In an embodiment, the compound is Z256. In an embodiment, the compound is Z257. In an embodiment, the compound is Z258. In an embodiment, the compound is Z259. In an embodiment, the compound is Z260. In an embodiment, the compound is Z261. In an embodiment, the compound is Z262. In an embodiment, the compound is Z263. In an embodiment, the compound is Z264. In an embodiment, the compound is Z265. In an embodiment, the compound is Z266. In an embodiment, the compound is Z267. In an embodiment, the compound is Z268. In an embodiment, the compound is Z269. In an embodiment, the compound is Z270. In an embodiment, the compound is Z271. In an embodiment, the compound is Z272. In an embodiment, the compound is Z273. In an embodiment, the compound is Z274. In an embodiment, the compound is Z275. In an embodiment, the compound is Z276. In an embodiment, the compound is Z277. In an embodiment, the compound is Z278. In an embodiment, the compound is Z279. In an embodiment, the compound is Z280. In an embodiment, the compound is Z281. In an embodiment, the compound is Z282. In an embodiment, the compound is Z283. In an embodiment, the compound is Z284. In an embodiment, the compound is Z285. In an embodiment, the compound is Z286. In an embodiment, the compound is Z287. In an embodiment, the compound is Z288. In an embodiment, the compound is Z289. In an embodiment, the compound is Z290. In an embodiment, the compound is Z291. In an embodiment, the compound is Z292. In an embodiment, the compound is Z293. In an embodiment, the compound is Z294. In an embodiment, the compound is Z295. In an embodiment, the compound is Z296. In an embodiment, the compound is Z297. In an embodiment, the compound is Z298. In an embodiment, the compound is Z299. In an embodiment, the compound is Z300. In an embodiment, the compound is Z301. In an embodiment, the compound is Z302. In an embodiment, the compound is Z303. In an embodiment, the compound is Z304. In an embodiment, the compound is Z305. In an embodiment, the compound is Z306. In an embodiment, the compound is Z307. In an embodiment, the compound is Z308. In an embodiment, the compound is Z309. In an embodiment, the compound is Z310. In an embodiment, the compound is Z311. In an embodiment, the compound is Z312. In an embodiment, the compound is Z313. In an embodiment, the compound is Z314. In an embodiment, the compound is Z315. In an embodiment, the compound is Z316. In an embodiment, the compound is Z317. In an embodiment, the compound is Z318. In an embodiment, the compound is Z319. In an embodiment, the compound is Z320. In an embodiment, the compound is Z321. In an embodiment, the compound is Z322. In an embodiment, the compound is Z323. In an embodiment, the compound is Z324. In an embodiment, the compound is Z325. In an embodiment, the compound is Z326. In an embodiment, the compound is Z327. In an embodiment, the compound is Z328. In an embodiment, the compound is Z329. In an embodiment, the compound is Z330. In an embodiment, the compound is Z331. In an embodiment, the compound is Z332. In an embodiment, the compound is Z333. In an embodiment, the compound is Z334. In an embodiment, the compound is Z335. In an embodiment, the compound is Z336. In an embodiment, the compound is Z337. In an embodiment, the compound is Z338. In an embodiment, the compound is Z339. In an embodiment, the compound is Z340. In an embodiment, the compound is Z341. In an embodiment, the compound is Z342. In an embodiment, the compound is Z343. In an embodiment, the compound is Z344. In an embodiment, the compound is Z345. In an embodiment, the compound is Z346. In an embodiment, the compound is Z347. In an embodiment, the compound is Z348. In an embodiment, the compound is Z349. In an embodiment, the compound is Z350. In an embodiment, the compound is Z351. In an embodiment, the compound is Z352. In an embodiment, the compound is Z353. In an embodiment, the compound is Z354. In an embodiment, the compound is Z355. In an embodiment, the compound is Z356. In an embodiment, the compound is Z357. In an embodiment, the compound is Z358. In an embodiment, the compound is Z359. In an embodiment, the compound is Z360. In an embodiment, the compound is Z361. In an embodiment, the compound is Z362. In an embodiment, the compound is Z363. In an embodiment, the compound is Z364. In an embodiment, the compound is Z365. In an embodiment, the compound is Z366. In an embodiment, the compound is Z367. In an embodiment, the compound is Z368. In the examples, the compound is Z369. In an embodiment, the compound is Z370. In an embodiment, the compound is Z371. In an embodiment, the compound is Z372. In embodiments, the compound is Z373. In an embodiment, the compound is Z374. In an embodiment, the compound is Z375. In an embodiment, the compound is Z376. In an embodiment, the compound is Z377. In an embodiment, the compound is Z378. In an embodiment, the compound is Z379. In an embodiment, the compound is Z380. In an embodiment, the compound is Z381. In an embodiment, the compound is Z382. In an embodiment, the compound is Z383. In an embodiment, the compound is Z384. In an embodiment, the compound is Z385. In an embodiment, compound is Z386. In an embodiment, the compound is Z387. In an embodiment, the compound is Z388. In an embodiment, the compound is Z389. In an embodiment, the compound is Z390. In an embodiment, the compound is Z391. In an embodiment, the compound is Z392. In an embodiment, the compound is Z393. In an embodiment, the compound is Z394. In an embodiment, the compound is Z395. In an embodiment, the compound is Z396. In an embodiment, the compound is Z397. In an embodiment, the compound is Z398. In an embodiment, the compound is Z399. In an embodiment, the compound is Z400. In an embodiment, the compound is Z401. In an embodiment, the compound is Z402. In an embodiment, the compound is Z403. In an embodiment, the compound is Z404. In an embodiment, the compound is Z405. In an embodiment, the compound is Z406. In an embodiment, the compound is Z407. In an embodiment, the compound is Z408. In an embodiment, the compound is Z409. In an embodiment, the compound is Z410. In an embodiment, the compound is Z411. In an embodiment, the compound is Z412. In an embodiment, the compound is Z413. In an embodiment, the compound is Z414. In an embodiment, the compound is Z415. In an embodiment, the compound is Z416. In an embodiment, the compound is Z417. In an embodiment, the compound is Z418. In an embodiment, the compound is Z419. In an embodiment, the compound is Z420. In an embodiment, the compound is Z421. In an embodiment, the compound is Z422. In an embodiment, the compound is Z423. In an embodiment, the compound is Z424. In an embodiment, the compound is Z425. In an embodiment, the compound is Z426. In an embodiment, the compound is Z427. In an embodiment, the compound is Z428. In an embodiment, the compound is Z429. In an embodiment, the compound is Z430. In an embodiment, the compound is Z431. In an embodiment, the compound is Z432. In an embodiment, the compound is Z433. In an embodiment, the compound is Z434. In an embodiment, the compound is Z435. In an embodiment, the compound is Z436. In an embodiment, the compound is Z437. In an embodiment, the compound is Z438. In an embodiment, the compound is Z439. In an embodiment, the compound is Z440. In an embodiment, the compound is Z441. In an embodiment, the compound is Z442. In an embodiment, the compound is Z443. In an embodiment, the compound is Z444. In an embodiment, the compound is Z445. In an embodiment, the compound is Z446. In an embodiment, the compound is Z447. In an embodiment, the compound is Z448. In an embodiment, the compound is Z449. In an embodiment, the compound is Z450. In an embodiment, the compound is Z451. In an embodiment, the compound is Z452. In an embodiment, the compound is Z453. In an embodiment, the compound is Z454. In an embodiment, the compound is Z455. In an embodiment, the compound is Z456. In an embodiment, the compound is Z457. In an embodiment, the compound is Z458. In an embodiment, the compound is Z459. In an embodiment, the compound is Z460. In an embodiment, the compound is Z461. In an embodiment, the compound is Z462. In an embodiment, the compound is Z463. In an embodiment, the compound is Z464. In an embodiment, the compound is Z465. In an embodiment, the compound is Z466. In an embodiment, the compound is Z467. In an embodiment, the compound is Z468. In an embodiment, the compound is Z469. In an embodiment, the compound is Z470. In an embodiment, the compound is Z471. In an embodiment, the compound is Z472. In an embodiment, the compound is Z473. In an embodiment, the compound is Z474. In an embodiment, the compound is Z475. In an embodiment, the compound is Z476. In an embodiment, the compound is Z477. In an embodiment, the compound is Z478. In an embodiment, the compound is Z479. In an embodiment, the compound is Z480. In an embodiment, the compound is Z481. In an embodiment, the compound is Z482. In an embodiment, the compound is Z483. In an embodiment, the compound is Z484. In an embodiment, the compound is Z485. In an embodiment, the compound is Z486. In an embodiment, the compound is Z487. In embodiments, the compound is Z488. In an embodiment, the compound is Z489. In an embodiment, the compound is Z490. In an embodiment, the compound is Z491. In an embodiment, the compound is Z492. In an embodiment, the compound is Z493. In an embodiment, the compound is Z494. In an embodiment, the compound is Z495. In an embodiment, the compound is Z496. In an embodiment, the compound is Z497. In an embodiment, the compound is Z498. In the examples, the compound is Z499. In an embodiment, the compound is Z500. In an embodiment, the compound is Z501. In an embodiment, the compound is Z502. In an embodiment, the compound is Z503. In an embodiment, the compound is Z504. In an embodiment, the compound is Z505. In an embodiment, the compound is Z506. In an embodiment, the compound is Z507. In an embodiment, the compound is Z508. In an embodiment, the compound is Z509. In an embodiment, the compound is Z510. In an embodiment, the compound is Z511. In an embodiment, the compound is Z512. In an embodiment, the compound is Z513. In an embodiment, the compound is Z514. In an embodiment, the compound is Z515. In an embodiment, the compound is Z516. In an embodiment, the compound is Z517. In an embodiment, the compound is Z518. In an embodiment, the compound is Z519. In an embodiment, the compound is Z520. In an embodiment, the compound is Z521. In an embodiment, the compound is Z522. In an embodiment, the compound is Z523. In an embodiment, the compound is Z524. In an embodiment, the compound is Z525. In an embodiment, the compound is Z526. In an embodiment, the compound is Z527. In an embodiment, the compound is Z528. In an embodiment, the compound is Z529. In an embodiment, the compound is Z530. In an embodiment, the compound is Z531. In an embodiment, the compound is Z532. In an embodiment, the compound is Z533. In an embodiment, the compound is Z534. In an embodiment, the compound is Z535. In an embodiment, the compound is Z536. In an embodiment, the compound is Z537. In an embodiment, the compound is Z538. In an embodiment, the compound is Z539. In an embodiment, the compound is Z540. In an embodiment, the compound is Z541. In an embodiment, the compound is Z542. In an embodiment, the compound is Z543. In an embodiment, the compound is Z544. In an embodiment, the compound is Z545. In an embodiment, the compound is Z546. In an embodiment, the compound is Z547. In an embodiment, the compound is Z548. In an embodiment, the compound is Z549. In an embodiment, the compound is Z550. In an embodiment, the compound is Z551. In an embodiment, the compound is Z552. In an embodiment, the compound is Z553. In an embodiment, the compound is Z554. In an embodiment, the compound is Z555. In an embodiment, the compound is Z556. In an embodiment, the compound is Z557. In an embodiment, the compound is Z558. In an embodiment, the compound is Z559. In an embodiment, the compound is Z560. In an embodiment, the compound is Z561. In an embodiment, the compound is Z562. In an embodiment, the compound is Z563. In an embodiment, the compound is Z564. In an embodiment, the compound is Z565. In an embodiment, the compound is Z566. In an embodiment, the compound is Z567. In an embodiment, the compound is Z568. In an embodiment, the compound is Z569. In an embodiment, the compound is Z570. In an embodiment, the compound is Z571. In an embodiment, the compound is Z572. In an embodiment, the compound is Z573. In an embodiment, the compound is Z574. In an embodiment, the compound is Z575. In an embodiment, the compound is Z576. In an embodiment, the compound is Z577. In an embodiment, the compound is Z578. In an embodiment, the compound is Z579. In an embodiment, the compound is Z580. In an embodiment, the compound is Z581. In an embodiment, the compound is Z582. In an embodiment, the compound is Z583. In an embodiment, the compound is Z584. In an embodiment, the compound is Z585. In an embodiment, the compound is Z586. In an embodiment, the compound is Z587. In an embodiment, the compound is Z588. In an embodiment, the compound is Z589. In an embodiment, the compound is Z590. In an embodiment, the compound is Z591. In an embodiment, the compound is Z592. In an embodiment, the compound is Z593. In an embodiment, the compound is Z594. In an embodiment, the compound is Z595. In an embodiment, the compound is Z596. In an embodiment, the compound is Z597. In an embodiment, the compound is Z598. In an embodiment, the compound is Z599. In an embodiment, the compound is Z600. In an embodiment, the compound is Z601. In an embodiment, the compound is Z602. In an embodiment, the compound is Z603. In an embodiment, the compound is Z604. In an embodiment, the compound is Z605. In an embodiment, the compound is Z606. In an embodiment, the compound is Z607. In an embodiment, the compound is Z608. In an embodiment, the compound is Z609. In an embodiment, the compound is Z610. In an embodiment, the compound is Z611. In an embodiment, the compound is Z612. In an embodiment, the compound is Z613. In an embodiment, the compound is Z614. In an embodiment, the compound is Z615. In an embodiment, the compound is Z616. In an embodiment, the compound is Z617. In an embodiment, the compound is Z618. In an embodiment, the compound is Z619. In an embodiment, the compound is Z620. In an embodiment, the compound is Z621. In an embodiment, the compound is Z622. In an embodiment, the compound is Z623. In an embodiment, the compound is Z624. In an embodiment, the compound is Z625. In an embodiment, the compound is Z626. In an embodiment, the compound is Z627. In an embodiment, the compound is Z628. In an embodiment, the compound is Z629. In an embodiment, the compound is Z630. In an embodiment, the compound is Z631. In an embodiment, the compound is Z632. In an embodiment, the compound is Z633. In an embodiment, the compound is Z634. In an embodiment, the compound is Z635. In an embodiment, the compound is Z636. In an embodiment, the compound is Z637. In an embodiment, the compound is Z638. In an embodiment, the compound is Z639. In an embodiment, the compound is Z640. In an embodiment, the compound is Z641. In an embodiment, the compound is Z642. In an embodiment, the compound is Z643. In an embodiment, the compound is Z644. In the examples, the compound is Z645. In an embodiment, the compound is Z646. In an embodiment, the compound is Z647.

In the examples, the compound is not:

in the examples, the compounds are notIn the examples, the compounds are notIn the examples, the compounds are not

In the examples, the compounds are notIn the examples, the compounds are not

In the examples, the compounds are notIn the examples, the compounds are notIn the examples, the compounds are not

In the examples, the compounds are notIn the examples, the compounds are notIn the examples, the compounds are notIn the examples, the compounds are notIn the examples, the compounds are not

In the examples, the compounds are not

In the examples, when R²And R³R forms unsubstituted heterocycloalkyl and z1 is 0⁴Is not hydrogen. In the examples, when R²Or R³Is hydrogen and L¹When it is an unsubstituted methylene group, R⁴Is not hydrogen. In the examples, when R²When is hydrogen, R³Is not unsubstituted cyclopropyl.

In the examples, when R²And R³R forms unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl) and z1 is 0⁴Is not hydrogen. In the examples, when R²And R³R when unsubstituted 3-to 8-membered heterocycloalkyl is formed and z1 is 0⁴Is not hydrogen. In the examples, when R²And R³R when unsubstituted 5-to 6-membered heterocycloalkyl is formed and z1 is 0⁴Is not hydrogen. In the examples, when R²And R³R forms an unsubstituted 5-membered heterocycloalkyl group and z1 is 0⁴Is not hydrogen. In the examples, when R²And R³Form an unsubstituted 6-membered heterocycloalkyl group and z1 is 0，R⁴Is not hydrogen. In the examples, R²And R³Unsubstituted 6-membered heterocycloalkyl is not formed. In the examples, R²And R³Unsubstituted 5-membered heterocycloalkyl is not formed.

In the examples, when R²And R³R when R forms a substituted or unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl) and z1 is 0⁴Is not hydrogen. In the examples, when R²And R³R when forming a substituted or unsubstituted 3-to 8-membered heterocycloalkyl group and z1 is 0⁴Is not hydrogen. In the examples, when R²And R³R when forming a substituted or unsubstituted 5-to 6-membered heterocycloalkyl group and z1 is 0⁴Is not hydrogen. In the examples, when R²And R³R forms a substituted or unsubstituted 5-membered heterocycloalkyl group and z1 is 0⁴Is not hydrogen. In the examples, when R²And R³R forms a substituted or unsubstituted 6-membered heterocycloalkyl group and z1 is 0⁴Is not hydrogen. In the examples, R²And R³A substituted or unsubstituted 6-membered heterocycloalkyl group is not formed. In the examples, R²And R³A substituted or unsubstituted 5-membered heterocycloalkyl group is not formed.

In the examples, when R²Or R³Is hydrogen and L¹Is unsubstituted alkylene (e.g. C)₁-C₈Alkylene radical, C₁-C₆Alkylene or C₁-C₄Alkylene) of R⁴Is not hydrogen. In the examples, when R²Or R³Is hydrogen and L¹Is unsubstituted C₁-C₈When it is alkylene, R⁴Is not hydrogen. In the examples, when R²Or R³Is hydrogen and L¹Is unsubstituted C₁-C₆When it is alkylene, R⁴Is not hydrogen. In the examples, when R²Or R³Is hydrogen and L¹Is unsubstituted C₁-C₄When it is alkylene, R⁴Is not hydrogen. In the examples, when R²Or R³Is hydrogen and L¹Is unsubstituted C₁-C₂When it is alkylene, R⁴Is not hydrogen. In the examples, when R²Or R³When is hydrogen, L¹C not unsubstituted₁-C₂An alkylene group. In the examples, when R²Or R³When is hydrogen, L¹C not unsubstituted₁-C₄An alkylene group.

In the examples, when R²Or R³Is hydrogen and L¹Is a substituted or unsubstituted alkylene (e.g., C)₁-C₈Alkylene radical, C₁-C₆Alkylene or C₁-C₄Alkylene) of R⁴Is not hydrogen. In the examples, when R²Or R³Is hydrogen and L¹Is substituted or unsubstituted C₁-C₈When it is alkylene, R⁴Is not hydrogen. In the examples, when R²Or R³Is hydrogen and L¹Is substituted or unsubstituted C₁-C₆When it is alkylene, R⁴Is not hydrogen. In the examples, when R²Or R³Is hydrogen and L¹Is substituted or unsubstituted C₁-C₄When it is alkylene, R⁴Is not hydrogen. In the examples, when R²Or R³Is hydrogen and L¹Is substituted or unsubstituted C₁-C₂When it is alkylene, R⁴Is not hydrogen. In the examples, when R²Or R³When is hydrogen, L¹C which is not substituted or unsubstituted₁-C₂An alkylene group. In the examples, when R²Or R³When is hydrogen, L¹C which is not substituted or unsubstituted₁-C₄An alkylene group.

In the examples, when R²When is hydrogen, R³Is not unsubstituted cyclopropyl. In the examples, when R²When is hydrogen, R³Cycloalkyl other than unsubstituted (e.g. C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups). In the examples, when R²When is hydrogen, R³Is not provided withUnsubstituted C₃-C₈A cycloalkyl group. In the examples, when R²When is hydrogen, R³C not unsubstituted₃-C₆A cycloalkyl group. In the examples, when R²When is hydrogen, R³C not unsubstituted₅-C₆A cycloalkyl group.

In the examples, when R²When is hydrogen, R³Is not a substituted or unsubstituted cyclopropyl group. In the examples, when R²When is hydrogen, R³Cycloalkyl which is not substituted or unsubstituted (e.g. C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups). In the examples, when R²When is hydrogen, R³C which is not substituted or unsubstituted₃-C₈A cycloalkyl group. In the examples, when R²When is hydrogen, R³C which is not substituted or unsubstituted₃-C₆A cycloalkyl group. In the examples, when R²When is hydrogen, R³C which is not substituted or unsubstituted₅-C₆A cycloalkyl group.

In the examples, R⁴Is not hydrogen. In the examples, R²Or R³Is not hydrogen. In the examples, L¹Is not an unsubstituted methylene group. In the examples, R³Is not unsubstituted cyclopropyl.

In the examples, when R²And R³When unsubstituted heterocycloalkyl (e.g., 3-to 8-membered heterocycloalkyl, 3-to 6-membered heterocycloalkyl, or 5-to 6-membered heterocycloalkyl) is formed, R⁴Is not hydrogen. In the examples, when R²And R³When unsubstituted 3-to 8-membered heterocycloalkyl is formed, R⁴Is not hydrogen. In the examples, when R²And R³When unsubstituted 5-to 6-membered heterocycloalkyl is formed, R⁴Is not hydrogen. In the examples, when R²And R³When unsubstituted 5-membered heterocycloalkyl is formed, R⁴Is not hydrogen. In the examples, when R²And R³When unsubstituted 6-membered heterocycloalkyl is formed, R⁴Is not hydrogen. In the examples, R²And R³Unsubstituted 6-membered heterocycloalkyl is not formed. In the examples, R²And R³Unsubstituted 5-membered heterocycloalkyl is not formed.

In the examples, when L¹Is unsubstituted alkylene (e.g. C)₁-C₈Alkylene radical, C₁-C₆Alkylene or C₁-C₄Alkylene) of R⁴Is not hydrogen. In the examples, when L¹Is unsubstituted C₁-C₈When it is alkylene, R⁴Is not hydrogen. In the examples, when L¹Is unsubstituted C₁-C₆When it is alkylene, R⁴Is not hydrogen. In the examples, when L¹Is unsubstituted C₁-C₄When it is alkylene, R⁴Is not hydrogen. In the examples, when L¹Is unsubstituted C₁-C₂When it is alkylene, R⁴Is not hydrogen. In the examples, L¹C not unsubstituted₁-C₂An alkylene group. In the examples, L¹C not unsubstituted₁-C₄An alkylene group.

In the examples, R³Is not unsubstituted cyclopropyl. In the examples, R³Cycloalkyl other than unsubstituted (e.g. C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups). In the examples, R³C not unsubstituted₃-C₈A cycloalkyl group. In the examples, R³C not unsubstituted₃-C₆A cycloalkyl group. In the examples, R³C not unsubstituted₅-C₆A cycloalkyl group. In the examples, R²Is not unsubstituted cyclopropyl. In the examples, R²Cycloalkyl other than unsubstituted (e.g. C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups). In the examples, R²C not unsubstituted₃-C₈A cycloalkyl group. In the examples, R²C not unsubstituted₃-C₆A cycloalkyl group. In the examples, R²C not unsubstituted₅-C₆A cycloalkyl group.

In the examples, R³Is not a substituted or unsubstituted cyclopropyl group. In the examples, R³Cycloalkyl which is not substituted or unsubstituted (e.g. C)₃-C₈Cycloalkyl radical, C₃-C₆Cycloalkyl or C₅-C₆Cycloalkyl groups). In the examples, R³C which is not substituted or unsubstituted₃-C₈A cycloalkyl group. In the examples, R³C which is not substituted or unsubstituted₃-C₆A cycloalkyl group. In the examples, R³C which is not substituted or unsubstituted₅-C₆A cycloalkyl group.

In an embodiment, the compound is not Z1. In an embodiment, the compound is not Z2. In an embodiment, the compound is not Z3. In an embodiment, the compound is not Z4. In an embodiment, the compound is not Z5. In an embodiment, the compound is not Z6. In an embodiment, the compound is not Z7. In an embodiment, the compound is not Z8. In an embodiment, the compound is not Z9. In an embodiment, the compound is not Z10. In an embodiment, the compound is not Z11. In an embodiment, the compound is not Z12. In an embodiment, the compound is not Z13. In an embodiment, the compound is not Z14. In an embodiment, the compound is not Z15. In an embodiment, the compound is not Z16. In an embodiment, the compound is not Z17. In an embodiment, the compound is not Z18. In an embodiment, the compound is not Z19. In an embodiment, the compound is not Z20. In an embodiment, the compound is not Z21. In an embodiment, the compound is not Z22. In an embodiment, the compound is not Z23. In an embodiment, the compound is not Z24. In an embodiment, the compound is not Z25. In an embodiment, the compound is not Z26. In an embodiment, the compound is not Z27. In an embodiment, the compound is not Z28. In an embodiment, the compound is not Z29. In an embodiment, the compound is not Z30. In an embodiment, the compound is not Z31. In an embodiment, the compound is not Z32. In an embodiment, the compound is not Z33. In an embodiment, the compound is not Z34. In an embodiment, the compound is not Z35. In an embodiment, the compound is not Z36. In an embodiment, the compound is not Z37. In an embodiment, the compound is not Z38. In an embodiment, the compound is not Z39. In an embodiment, the compound is not Z40. In an embodiment, the compound is not Z41. In an embodiment, the compound is not Z42. In an embodiment, the compound is not Z43. In an embodiment, the compound is not Z44. In an embodiment, the compound is not Z45. In an embodiment, the compound is not Z46. In an embodiment, the compound is not Z47. In an embodiment, the compound is not Z48. In an embodiment, the compound is not Z49. In an embodiment, the compound is not Z50. In an embodiment, the compound is not Z51. In an embodiment, the compound is not Z52. In an embodiment, the compound is not Z53. In an embodiment, the compound is not Z54. In an embodiment, the compound is not Z55. In an embodiment, the compound is not Z56. In an embodiment, the compound is not Z57. In an embodiment, the compound is not Z58. In an embodiment, the compound is not Z59. In an embodiment, the compound is not Z60. In an embodiment, the compound is not Z61. In an embodiment, the compound is not Z62. In an embodiment, the compound is not Z63. In an embodiment, the compound is not Z64. In an embodiment, the compound is not Z65. In an embodiment, the compound is not Z66. In an embodiment, the compound is not Z67. In an embodiment, the compound is not Z68. In an embodiment, the compound is not Z69. In an embodiment, the compound is not Z70. In an embodiment, the compound is not Z71. In an embodiment, the compound is not Z72. In an embodiment, the compound is not Z73. In an embodiment, the compound is not Z74. In an embodiment, the compound is not Z75. In an embodiment, the compound is not Z76. In an embodiment, the compound is not Z77. In an embodiment, the compound is not Z78. In an embodiment, the compound is not Z79. In an embodiment, the compound is not Z80. In an embodiment, the compound is not Z81. In an embodiment, the compound is not Z82. In an embodiment, the compound is not Z83. In an embodiment, the compound is not Z84. In an embodiment, the compound is not Z85. In an embodiment, the compound is not Z86. In an embodiment, the compound is not Z87. In an embodiment, the compound is not Z88. In an embodiment, the compound is not Z89. In an embodiment, the compound is not Z90. In an embodiment, the compound is not Z91. In an embodiment, the compound is not Z92. In an embodiment, the compound is not Z93. In an embodiment, the compound is not Z94. In an embodiment, the compound is not Z95. In an embodiment, the compound is not Z96. In an embodiment, the compound is not Z97. In an embodiment, the compound is not Z98. In an embodiment, the compound is not Z99. In embodiments, the compound is not Z100. In an embodiment, the compound is not Z101. In embodiments, the compound is not Z102. In embodiments, the compound is not Z103. In embodiments, the compound is not Z104. In an embodiment, the compound is not Z105. In an embodiment, the compound is not Z106. In an embodiment, the compound is not Z107. In an embodiment, the compound is not Z108. In an embodiment, the compound is not Z109. In an embodiment, the compound is not Z110. In embodiments, the compound is not Z111. In an embodiment, the compound is not Z112. In an embodiment, the compound is not Z113. In an embodiment, the compound is not Z114. In an embodiment, the compound is not Z115. In embodiments, the compound is not Z116. In an embodiment, the compound is not Z117. In embodiments, the compound is not Z118. In an embodiment, the compound is not Z119. In embodiments, the compound is not Z120. In an embodiment, the compound is not Z121. In an embodiment, the compound is not Z122. In an embodiment, the compound is not Z123. In an embodiment, the compound is not Z124. In embodiments, the compound is not Z125. In an embodiment, the compound is not Z126. In an embodiment, the compound is not Z127. In embodiments, the compound is not Z128. In an embodiment, the compound is not Z129. In an embodiment, the compound is not Z130. In an embodiment, the compound is not Z131. In an embodiment, the compound is not Z132. In an embodiment, the compound is not Z133. In an embodiment, the compound is not Z134. In an embodiment, the compound is not Z135. In an embodiment, the compound is not Z136. In an embodiment, the compound is not Z137. In an embodiment, the compound is not Z138. In an embodiment, the compound is not Z139. In an embodiment, the compound is not Z140. In an embodiment, the compound is not Z141. In an embodiment, the compound is not Z142. In an embodiment, the compound is not Z143. In an embodiment, the compound is not Z144. In embodiments, the compound is not Z145. In an embodiment, the compound is not Z146. In the examples, the compound is not Z147. In an embodiment, the compound is not Z148. In an embodiment, the compound is not Z149. In an embodiment, the compound is not Z150. In an embodiment, the compound is not Z151. In embodiments, the compound is not Z152. In an embodiment, the compound is not Z153. In an embodiment, the compound is not Z154. In an embodiment, the compound is not Z155. In an embodiment, the compound is not Z156. In an embodiment, the compound is not Z157. In an embodiment, the compound is not Z158. In an embodiment, the compound is not Z159. In an embodiment, the compound is not Z160. In an embodiment, the compound is not Z161. In an embodiment, the compound is not Z162. In an embodiment, the compound is not Z163. In embodiments, the compound is not Z164. In an embodiment, the compound is not Z165. In an embodiment, the compound is not Z166. In embodiments, the compound is not Z167. In an embodiment, the compound is not Z168. In an embodiment, the compound is not Z169. In an embodiment, the compound is not Z170. In an embodiment, the compound is not Z171. In embodiments, the compound is not Z172. In an embodiment, the compound is not Z173. In embodiments, the compound is not Z174. In an embodiment, the compound is not Z175. In embodiments, the compound is not Z176. In the examples, the compound is not Z177. In an embodiment, the compound is not Z178. In the examples, the compound is not Z179. In an embodiment, the compound is not Z180. In an embodiment, the compound is not Z181. In an embodiment, the compound is not Z182. In an embodiment, the compound is not Z183. In an embodiment, the compound is not Z184. In an embodiment, the compound is not Z185. In an embodiment, the compound is not Z186. In an embodiment, the compound is not Z187. In an embodiment, the compound is not Z188. In an embodiment, the compound is not Z189. In an embodiment, the compound is not Z190. In an embodiment, the compound is not Z191. In an embodiment, the compound is not Z192. In an embodiment, the compound is not Z193. In an embodiment, the compound is not Z194. In an embodiment, the compound is not Z195. In an embodiment, the compound is not Z196. In an embodiment, the compound is not Z197. In an embodiment, the compound is not Z198. In an embodiment, the compound is not Z199. In an embodiment, the compound is not Z200. In an embodiment, the compound is not Z201. In an embodiment, the compound is not Z202. In an embodiment, the compound is not Z203. In an embodiment, the compound is not Z204. In an embodiment, the compound is not Z205. In an embodiment, the compound is not Z206. In an embodiment, the compound is not Z207. In an embodiment, the compound is not Z208. In an embodiment, the compound is not Z209. In an embodiment, the compound is not Z210. In an embodiment, the compound is not Z211. In an embodiment, the compound is not Z212. In an embodiment, the compound is not Z213. In embodiments, the compound is not Z214. In an embodiment, the compound is not Z215. In an embodiment, the compound is not Z216. In an embodiment, the compound is not Z217. In an embodiment, the compound is not Z218. In an embodiment, the compound is not Z219. In an embodiment, the compound is not Z220. In an embodiment, the compound is not Z221. In an embodiment, the compound is not Z222. In an embodiment, the compound is not Z223. In an embodiment, the compound is not Z224. In an embodiment, the compound is not Z225. In an embodiment, the compound is not Z226. In an embodiment, the compound is not Z227. In an embodiment, the compound is not Z228. In an embodiment, the compound is not Z229. In an embodiment, the compound is not Z230. In embodiments, the compound is not Z231. In an embodiment, the compound is not Z232. In an embodiment, the compound is not Z233. In an embodiment, the compound is not Z234. In an embodiment, the compound is not Z235. In an embodiment, the compound is not Z236. In embodiments, the compound is not Z237. In an embodiment, the compound is not Z238. In embodiments, the compound is not Z239. In an embodiment, the compound is not Z240. In an embodiment, the compound is not Z241. In an embodiment, the compound is not Z242. In an embodiment, the compound is not Z243. In an embodiment, the compound is not Z244. In an embodiment, the compound is not Z245. In an embodiment, the compound is not Z246. In an embodiment, the compound is not Z247. In embodiments, the compound is not Z248. In the examples, the compound is not Z249. In an embodiment, the compound is not Z250. In an embodiment, the compound is not Z251. In an embodiment, the compound is not Z252. In an embodiment, the compound is not Z253. In an embodiment, the compound is not Z254. In an embodiment, the compound is not Z255. In an embodiment, the compound is not Z256. In the examples, the compound is not Z257. In an embodiment, the compound is not Z258. In an embodiment, the compound is not Z259. In embodiments, the compound is not Z260. In an embodiment, the compound is not Z261. In an embodiment, the compound is not Z262. In an embodiment, the compound is not Z263. In an embodiment, the compound is not Z264. In an embodiment, the compound is not Z265. In an embodiment, the compound is not Z266. In an embodiment, the compound is not Z267. In an embodiment, the compound is not Z268. In an embodiment, the compound is not Z269. In an embodiment, the compound is not Z270. In an embodiment, the compound is not Z271. In embodiments, the compound is not Z272. In embodiments, the compound is not Z273. In an embodiment, the compound is not Z274. In an embodiment, the compound is not Z275. In an embodiment, the compound is not Z276. In an embodiment, the compound is not Z277. In an embodiment, the compound is not Z278. In an embodiment, the compound is not Z279. In an embodiment, the compound is not Z280. In an embodiment, the compound is not Z281. In an embodiment, the compound is not Z282. In an embodiment, the compound is not Z283. In an embodiment, the compound is not Z284. In an embodiment, the compound is not Z285. In embodiments, the compound is not Z286. In embodiments, the compound is not Z287. In embodiments, the compound is not Z288. In the examples, the compound is not Z289. In an embodiment, the compound is not Z290. In an embodiment, the compound is not Z291. In an embodiment, the compound is not Z292. In an embodiment, the compound is not Z293. In embodiments, the compound is not Z294. In an embodiment, the compound is not Z295. In an embodiment, the compound is not Z296. In an embodiment, the compound is not Z297. In an embodiment, the compound is not Z298. In embodiments, the compound is not Z299. In an embodiment, the compound is not Z300. In an embodiment, the compound is not Z301. In an embodiment, the compound is not Z302. In an embodiment, the compound is not Z303. In an embodiment, the compound is not Z304. In an embodiment, the compound is not Z305. In an embodiment, the compound is not Z306. In an embodiment, the compound is not Z307. In an embodiment, the compound is not Z308. In an embodiment, the compound is not Z309. In an embodiment, the compound is not Z310. In embodiments, the compound is not Z311. In an embodiment, the compound is not Z312. In an embodiment, the compound is not Z313. In an embodiment, the compound is not Z314. In an embodiment, the compound is not Z315. In an embodiment, the compound is not Z316. In an embodiment, the compound is not Z317. In an embodiment, the compound is not Z318. In embodiments, the compound is not Z319. In an embodiment, the compound is not Z320. In an embodiment, the compound is not Z321. In embodiments, the compound is not Z322. In an embodiment, the compound is not Z323. In an embodiment, the compound is not Z324. In an embodiment, the compound is not Z325. In an embodiment, the compound is not Z326. In an embodiment, the compound is not Z327. In an embodiment, the compound is not Z328. In an embodiment, the compound is not Z329. In an embodiment, the compound is not Z330. In an embodiment, the compound is not Z331. In an embodiment, the compound is not Z332. In an embodiment, the compound is not Z333. In an embodiment, the compound is not Z334. In an embodiment, the compound is not Z335. In an embodiment, the compound is not Z336. In an embodiment, the compound is not Z337. In an embodiment, the compound is not Z338. In an embodiment, the compound is not Z339. In an embodiment, the compound is not Z340. In an embodiment, the compound is not Z341. In an embodiment, the compound is not Z342. In an embodiment, the compound is not Z343. In an embodiment, the compound is not Z344. In an embodiment, the compound is not Z345. In an embodiment, the compound is not Z346. In an embodiment, the compound is not Z347. In an embodiment, the compound is not Z348. In embodiments, the compound is not Z349. In an embodiment, the compound is not Z350. In an embodiment, the compound is not Z351. In an embodiment, the compound is not Z352. In the examples, the compound is not Z353. In an embodiment, the compound is not Z354. In an embodiment, the compound is not Z355. In an embodiment, the compound is not Z356. In embodiments, the compound is not Z357. In an embodiment, the compound is not Z358. In an embodiment, the compound is not Z359. In an embodiment, the compound is not Z360. In an embodiment, the compound is not Z361. In an embodiment, the compound is not Z362. In embodiments, the compound is not Z363. In an embodiment, the compound is not Z364. In an embodiment, the compound is not Z365. In an embodiment, the compound is not Z366. In an embodiment, the compound is not Z367. In an embodiment, the compound is not Z368. In the examples, the compound is not Z369. In an embodiment, the compound is not Z370. In an embodiment, the compound is not Z371. In an embodiment, the compound is not Z372. In embodiments, the compound is not Z373. In an embodiment, the compound is not Z374. In an embodiment, the compound is not Z375. In an embodiment, the compound is not Z376. In an embodiment, the compound is not Z377. In an embodiment, the compound is not Z378. In an embodiment, the compound is not Z379. In an embodiment, the compound is not Z380. In an embodiment, the compound is not Z381. In an embodiment, the compound is not Z382. In an embodiment, the compound is not Z383. In an embodiment, the compound is not Z384. In an embodiment, the compound is not Z385. In an embodiment, the compound is not Z386. In an embodiment, the compound is not Z387. In an embodiment, the compound is not Z388. In an embodiment, the compound is not Z389. In embodiments, the compound is not Z390. In an embodiment, the compound is not Z391. In embodiments, the compound is not Z392. In the examples, the compound is not Z393. In an embodiment, the compound is not Z394. In embodiments, the compound is not Z395. In the examples, the compound is not Z396. In embodiments, the compound is not Z397. In an embodiment, the compound is not Z398. In embodiments, the compound is not Z399. In an embodiment, the compound is not Z400. In an embodiment, the compound is not Z401. In an embodiment, the compound is not Z402. In an embodiment, the compound is not Z403. In an embodiment, the compound is not Z404. In an embodiment, the compound is not Z405. In an embodiment, the compound is not Z406. In an embodiment, the compound is not Z407. In an embodiment, the compound is not Z408. In an embodiment, the compound is not Z409. In an embodiment, the compound is not Z410. In an embodiment, the compound is not Z411. In an embodiment, the compound is not Z412. In an embodiment, the compound is not Z413. In an embodiment, the compound is not Z414. In embodiments, the compound is not Z415. In embodiments, the compound is not Z416. In embodiments, the compound is not Z417. In embodiments, the compound is not Z418. In an embodiment, the compound is not Z419. In an embodiment, the compound is not Z420. In an embodiment, the compound is not Z421. In an embodiment, the compound is not Z422. In an embodiment, the compound is not Z423. In an embodiment, the compound is not Z424. In embodiments, the compound is not Z425. In an embodiment, the compound is not Z426. In an embodiment, the compound is not Z427. In an embodiment, the compound is not Z428. In the examples, the compound is not Z429. In an embodiment, the compound is not Z430. In an embodiment, the compound is not Z431. In an embodiment, the compound is not Z432. In an embodiment, the compound is not Z433. In an embodiment, the compound is not Z434. In an embodiment, the compound is not Z435. In an embodiment, the compound is not Z436. In embodiments, the compound is not Z437. In an embodiment, the compound is not Z438. In embodiments, the compound is not Z439. In an embodiment, the compound is not Z440. In an embodiment, the compound is not Z441. In an embodiment, the compound is not Z442. In an embodiment, the compound is not Z443. In an embodiment, the compound is not Z444. In an embodiment, the compound is not Z445. In an embodiment, the compound is not Z446. In an embodiment, the compound is not Z447. In an embodiment, the compound is not Z448. In an embodiment, the compound is not Z449. In embodiments, the compound is not Z450. In an embodiment, the compound is not Z451. In an embodiment, the compound is not Z452. In an embodiment, the compound is not Z453. In an embodiment, the compound is not Z454. In an embodiment, the compound is not Z455. In an embodiment, the compound is not Z456. In an embodiment, the compound is not Z457. In an embodiment, the compound is not Z458. In an embodiment, the compound is not Z459. In an embodiment, the compound is not Z460. In an embodiment, the compound is not Z461. In an embodiment, the compound is not Z462. In embodiments, the compound is not Z463. In an embodiment, the compound is not Z464. In an embodiment, the compound is not Z465. In an embodiment, the compound is not Z466. In embodiments, the compound is not Z467. In an embodiment, the compound is not Z468. In the examples, the compound is not Z469. In an embodiment, the compound is not Z470. In an embodiment, the compound is not Z471. In an embodiment, the compound is not Z472. In an embodiment, the compound is not Z473. In an embodiment, the compound is not Z474. In embodiments, the compound is not Z475. In an embodiment, the compound is not Z476. In an embodiment, the compound is not Z477. In an embodiment, the compound is not Z478. In an embodiment, the compound is not Z479. In an embodiment, the compound is not Z480. In an embodiment, the compound is not Z481. In an embodiment, the compound is not Z482. In an embodiment, the compound is not Z483. In an embodiment, the compound is not Z484. In an embodiment, the compound is not Z485. In an embodiment, the compound is not Z486. In an embodiment, the compound is not Z487. In embodiments, the compound is not Z488. In the examples, the compound is not Z489. In an embodiment, the compound is not Z490. In an embodiment, the compound is not Z491. In an embodiment, the compound is not Z492. In embodiments, the compound is not Z493. In an embodiment, the compound is not Z494. In the examples, the compound is not Z495. In an embodiment, the compound is not Z496. In an embodiment, the compound is not Z497. In embodiments, the compound is not Z498. In the examples, the compound is not Z499. In an embodiment, the compound is not Z500. In an embodiment, the compound is not Z501. In an embodiment, the compound is not Z502. In an embodiment, the compound is not Z503. In an embodiment, the compound is not Z504. In an embodiment, the compound is not Z505. In an embodiment, the compound is not Z506. In an embodiment, the compound is not Z507. In an embodiment, the compound is not Z508. In an embodiment, the compound is not Z509. In an embodiment, the compound is not Z510. In an embodiment, the compound is not Z511. In an embodiment, the compound is not Z512. In an embodiment, the compound is not Z513. In an embodiment, the compound is not Z514. In an embodiment, the compound is not Z515. In an embodiment, the compound is not Z516. In an embodiment, the compound is not Z517. In an embodiment, the compound is not Z518. In an embodiment, the compound is not Z519. In an embodiment, the compound is not Z520. In an embodiment, the compound is not Z521. In an embodiment, the compound is not Z522. In an embodiment, the compound is not Z523. In an embodiment, the compound is not Z524. In an embodiment, the compound is not Z525. In an embodiment, the compound is not Z526. In the examples, the compound is not Z527. In an embodiment, the compound is not Z528. In an embodiment, the compound is not Z529. In an embodiment, the compound is not Z530. In an embodiment, the compound is not Z531. In an embodiment, the compound is not Z532. In an embodiment, the compound is not Z533. In an embodiment, the compound is not Z534. In embodiments, the compound is not Z535. In an embodiment, the compound is not Z536. In an embodiment, the compound is not Z537. In an embodiment, the compound is not Z538. In the examples, the compound is not Z539. In an embodiment, the compound is not Z540. In an embodiment, the compound is not Z541. In an embodiment, the compound is not Z542. In an embodiment, the compound is not Z543. In an embodiment, the compound is not Z544. In an embodiment, the compound is not Z545. In an embodiment, the compound is not Z546. In an embodiment, the compound is not Z547. In an embodiment, the compound is not Z548. In an embodiment, the compound is not Z549. In an embodiment, the compound is not Z550. In an embodiment, the compound is not Z551. In an embodiment, the compound is not Z552. In an embodiment, the compound is not Z553. In an embodiment, the compound is not Z554. In embodiments, the compound is not Z555. In an embodiment, the compound is not Z556. In an embodiment, the compound is not Z557. In an embodiment, the compound is not Z558. In an embodiment, the compound is not Z559. In an embodiment, the compound is not Z560. In an embodiment, the compound is not Z561. In an embodiment, the compound is not Z562. In an embodiment, the compound is not Z563. In an embodiment, the compound is not Z564. In an embodiment, the compound is not Z565. In an embodiment, the compound is not Z566. In an embodiment, the compound is not Z567. In an embodiment, the compound is not Z568. In an embodiment, the compound is not Z569. In an embodiment, the compound is not Z570. In an embodiment, the compound is not Z571. In an embodiment, the compound is not Z572. In an embodiment, the compound is not Z573. In an embodiment, the compound is not Z574. In an embodiment, the compound is not Z575. In an embodiment, the compound is not Z576. In embodiments, the compound is not Z577. In an embodiment, the compound is not Z578. In embodiments, the compound is not Z579. In an embodiment, the compound is not Z580. In an embodiment, the compound is not Z581. In an embodiment, the compound is not Z582. In the examples, the compound is not Z583. In an embodiment, the compound is not Z584. In an embodiment, the compound is not Z585. In an embodiment, the compound is not Z586. In the examples, the compound is not Z587. In an embodiment, the compound is not Z588. In the examples, the compound is not Z589. In embodiments, the compound is not Z590. In an embodiment, the compound is not Z591. In an embodiment, the compound is not Z592. In an embodiment, the compound is not Z593. In an embodiment, the compound is not Z594. In an embodiment, the compound is not Z595. In an embodiment, the compound is not Z596. In an embodiment, the compound is not Z597. In an embodiment, the compound is not Z598. In an embodiment, the compound is not Z599. In an embodiment, the compound is not Z600. In an embodiment, the compound is not Z601. In an embodiment, the compound is not Z602. In the examples, the compound is not Z603. In an embodiment, the compound is not Z604. In an embodiment, the compound is not Z605. In an embodiment, the compound is not Z606. In an embodiment, the compound is not Z607. In an embodiment, the compound is not Z608. In an embodiment, the compound is not Z609. In an embodiment, the compound is not Z610. In an embodiment, the compound is not Z611. In an embodiment, the compound is not Z612. In an embodiment, the compound is not Z613. In an embodiment, the compound is not Z614. In an embodiment, the compound is not Z615. In an embodiment, the compound is not Z616. In an embodiment, the compound is not Z617. In an embodiment, the compound is not Z618. In an embodiment, the compound is not Z619. In an embodiment, the compound is not Z620. In an embodiment, the compound is not Z621. In embodiments, the compound is not Z622. In an embodiment, the compound is not Z623. In an embodiment, the compound is not Z624. In an embodiment, the compound is not Z625. In an embodiment, the compound is not Z626. In embodiments, the compound is not Z627. In an embodiment, the compound is not Z628. In an embodiment, the compound is not Z629. In an embodiment, the compound is not Z630. In an embodiment, the compound is not Z631. In an embodiment, the compound is not Z632. In an embodiment, the compound is not Z633. In an embodiment, the compound is not Z634. In an embodiment, the compound is not Z635. In embodiments, the compound is not Z636. In an embodiment, the compound is not Z637. In an embodiment, the compound is not Z638. In an embodiment, the compound is not Z639. In an embodiment, the compound is not Z640. In an embodiment, the compound is not Z641. In an embodiment, the compound is not Z642. In an embodiment, the compound is not Z643. In an embodiment, the compound is not Z644. In the examples, the compound is not Z645. In an embodiment, the compound is not Z646. In an embodiment, the compound is not Z647.

In embodiments, the compound has the formula:

ring A, ring B, L¹、R¹、R⁴、R⁵、R⁶Z1 and z6 are as described herein. In the examples, R⁵Is unsubstituted alkyl. In the examples, R⁵Is unsubstituted C₁-C₄An alkyl group. In the examples, R⁵Is unsubstituted C₁-C₃An alkyl group. In the examples, R⁵Is unsubstituted C₁-C₂An alkyl group. In the examples, R⁵Is unsubstituted tert-butyl. In the examples, R⁵Is unsubstituted isobutyl. In the examples, R⁵Is unsubstituted sec-butyl. In the examples, R⁵Is unsubstituted n-butyl. In the examples, R⁵Is unsubstituted isopropyl. In the examples, R⁵Is unsubstituted n-propyl. In the examples, R⁵Is an unsubstituted ethyl group. In the examples, R⁵Is unsubstituted methyl. In the examples, R⁵Is unsubstituted hydrogen. In the examples, R⁴Is unsubstituted alkyl. In the examples, R⁴Is unsubstituted C₁-C₄An alkyl group. In the examples, R⁴Is unsubstituted C₁-C₃An alkyl group. In the examples, R⁴Is unsubstituted C₁-C₂An alkyl group. In the examples, R⁴Is unsubstituted tert-butyl. In the examples, R⁴Is unsubstituted isobutyl. In the examples, R⁴Is unsubstituted sec-butyl. In the examples, R⁴Is unsubstituted n-butyl. In the examples, R⁴Is unsubstituted isopropyl. In the examples, R⁴Is unsubstituted n-propyl. In the examples, R⁴Is an unsubstituted ethyl group. In the examples, R⁴Is unsubstituted methyl. In the examples, R⁴Is unsubstituted hydrogen. In the examples, L¹Is an unsubstituted alkylene group. In the implementation ofIn the examples, L¹Is unsubstituted C₁-C₄An alkylene group. In the examples, L¹Is unsubstituted C₁-C₃An alkylene group. In the examples, L¹Is unsubstituted C₁-C₂An alkylene group. In the examples, L¹Is unsubstituted tert-butylidene. In the examples, L¹Is unsubstituted isobutylene. In the examples, L¹Is unsubstituted sec-butylene. In the examples, L¹Is unsubstituted n-butylene. In the examples, L¹Is unsubstituted isopropylidene. In the examples, L¹Is unsubstituted n-propylene. In the examples, L¹Is an unsubstituted ethylene group. In the examples, L¹Is an unsubstituted methylene group. In the examples, L¹Is a bond. In the examples, L¹Is that

In the examples, L¹Is thatIn the examples, L¹Is thatIn the examples, L¹Is thatIn the examples, L¹Is thatIn the examples, L¹Is thatIn the examples, L¹Is that

In the examples, L¹Is thatIn the examples, L¹Is thatIn the examples, L¹Is that

In the examples, L¹Is thatIn the examples, L¹Is that

In the examples, L¹Is that

In the examples, L¹Is thatIn the examples, L¹Is thatIn the examples, L¹Is thatIn the examples, L¹Is thatIn the examples, L¹Is that

In the examples, L¹Is thatIn the examples, L¹Is that

In embodiments, ring a is pyridyl. In embodiments, ring a is 2-pyridyl. In embodiments, ring a is 3-pyridyl. In embodiments, ring a is 4-pyridyl. In embodiments, ring a is pyrrolyl. In embodiments, ring A is 2-pyrrolyl. In embodiments, ring A is 3-pyrrolyl. In embodiments, ring a is azetidinyl. In embodiments, ring a is 2-azetidinyl. In embodiments, ring A is 3-azetidinyl. In the examples, R¹Independently is-OH. In the examples, R¹Independently is-OCH₃. In the examples, R¹Independently is-OCH₂CH₃. In the examples, R¹Independently is unsubstituted C₁-C₄An alkoxy group. In the examples, R¹Independently is-Cl. In the examples, R¹Independently is-F. In the examples, R¹Independently a halogen. In the examples, R¹Independently is-CH₃. In the examples, R¹Independently is-CH₂CH₃. In the examples, R¹Independently is unsubstituted C₁-C₄An alkyl group. In the examples, R¹Independently is-CF₃. In the examples, R¹Independently is-CX¹ ₃. In an embodiment, z1 is an integer from 0 to 5. In an embodiment, z1 is an integer from 0 to 2. In an embodiment, z1 is 0. In an embodiment, z1Is 1. In an embodiment, z1 is 2. In an embodiment, z1 is 3. In an embodiment, z1 is 4. In an embodiment, z1 is 5. In the examples, R⁶Independently is-OH. In the examples, R⁶Independently is-OCH₃. In the examples, R⁶Independently is-OCH₂CH₃. In the examples, R⁶Independently is unsubstituted C₁-C₄An alkoxy group. In the examples, R⁶Independently is-Cl. In the examples, R⁶Independently is-F. In the examples, R⁶Independently is-Br. In the examples, R⁶Independently is-I. In the examples, R⁶Independently a halogen. In the examples, R⁶Independently is-CH₃. In the examples, R⁶Independently is-CH₂CH₃. In the examples, R⁶Independently is unsubstituted C₁-C₄An alkyl group. In the examples, R⁶Independently is-CF₃. In the examples, R⁶Independently is-CCl₃. In the examples, R⁶Independently is-CBr₃. In the examples, R⁶Independently is-CI₃. In the examples, R⁶Independently is-CX⁶ ₃. In embodiments, ring B is heterocycloalkyl. In embodiments, ring B is a 4-to 6-membered heterocycloalkyl. In embodiments, ring B is a 4-membered heterocycloalkyl. In embodiments, ring B is a 5-membered heterocycloalkyl. In embodiments, ring B is a 6-membered heterocycloalkyl. In embodiments, ring B is azetidinyl. In embodiments, ring B is pyrrolidinyl. In embodiments, ring B is piperidinyl. In an embodiment, z6 is an integer from 0 to 8. In an embodiment, z6 is an integer from 0 to 2. In an embodiment, z6 is 0. In an embodiment, z6 is 1. In an embodiment, z6 is 2. In an embodiment, z6 is 3. In an embodiment, z6 is 4. In an embodiment, z6 is 5. In an embodiment, z6 is 6. In an embodiment, z6 is 7. In an embodiment, z6 is 8. In an embodiment, z6 is 9. In an embodiment, z6 is 10. In the examples, - (Ring B) - (R)⁶)_z6Is that

In the examples, - (Ring B) - (R)⁶)_z6Is thatIn the examples, - (Ring B) - (R)⁶)_z6Is that

In the examples, - (Ring B) - (R)⁶)_z6Is that

In the examples, - (Ring B) - (R)⁶)_z6Is thatIn the examples, - (Ring B) - (R)⁶)_z6Is that

In an embodiment, the compound is Z297.

Pharmaceutical composition

In one aspect, there is provided a pharmaceutical composition comprising a compound as described herein and a pharmaceutically acceptable excipient.

In an embodiment of the pharmaceutical composition, a therapeutically effective amount of the compound, or a pharmaceutically acceptable salt thereof, is included.

In an embodiment of the pharmaceutical composition, the pharmaceutical composition comprises a second agent (e.g., a therapeutic agent). In an embodiment of the pharmaceutical composition, the pharmaceutical composition comprises a therapeutically effective amount of a second agent (e.g., a therapeutic agent). In an embodiment of the pharmaceutical composition, the second agent is an agent for treating cancer. In embodiments, the second agent is an anti-cancer agent. In an embodiment, the second agent is chemotherapy. In embodiments, the second agent is an anti-inflammatory agent. In embodiments, administration does not comprise administration of any active agent other than the recited active agent (e.g., a compound described herein). In embodiments, the second agent is an anti-fibrotic agent. In embodiments, the second agent is an anti-neurodegenerative disease agent. In an embodiment, the second agent is an agent for treating fibrosis. In an embodiment, the second agent is an agent for treating a neurodegenerative disease.

Method of use

In one aspect, there is provided a method of inhibiting adenosine A2B receptor activity and adenosine A2A receptor activity, the method comprising contacting the adenosine A2B receptor and adenosine A2A receptor with a compound as described herein (including the examples). In embodiments, the compounds contact the adenosine A2B receptor. In embodiments, the compounds contact the adenosine A2A receptor. In embodiments, the compounds are capable of contacting the adenosine A2A receptor and the adenosine A2B receptor independently. In embodiments, the compound does not contact the adenosine A2A receptor and the adenosine A2B receptor simultaneously.

In embodiments, the method inhibits adenosine A2B receptor activity to adenosine A2A receptor activity at a ratio of about 1: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine A2A receptor activity at a ratio of about 2: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine A2A receptor activity at a ratio of about 3: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine A2A receptor activity at a ratio of about 4: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine A2A receptor activity at a ratio of about 5: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine A2A receptor activity at a ratio of about 6: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine A2A receptor activity at a ratio of about 7: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine A2A receptor activity at a ratio of about 8: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine A2A receptor activity at a ratio of about 9: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine A2A receptor activity at a ratio of about 10: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine A2A receptor activity at a ratio of about 20: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine A2A receptor activity at a ratio of about 25: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine A2A receptor activity at a ratio of about 30: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine A2A receptor activity at a ratio of about 40: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine A2A receptor activity at a ratio of about 50: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine A2A receptor activity at a ratio of about 100: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine A2A receptor activity at a ratio of about 200: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine A2A receptor activity at a ratio of about 300: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine A2A receptor activity at a ratio of about 400: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine A2A receptor activity at a ratio of about 500: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine A2A receptor activity at a ratio of about 600: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine A2A receptor activity at a ratio of about 700: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine A2A receptor activity at a ratio of about 800: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine A2A receptor activity at a ratio of about 900: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine A2A receptor activity at a ratio of about 1000: about 1.

In another aspect, there is provided a method of inhibiting the activity of the adenosine A2B receptor, which method comprises contacting the adenosine A2B receptor with a compound as described herein (including the examples). In embodiments, the methods inhibit adenosine A2B receptor activity relative to a control. In embodiments, the method inhibits adenosine A2B receptor activity greater than adenosine A3 receptor activity. In embodiments, the method inhibits adenosine A2B receptor activity greater than adenosine a1 receptor activity.

In embodiments, the method inhibits adenosine A2B receptor activity to adenosine A3 receptor activity at a ratio of about 1: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine A3 receptor activity at a ratio of about 2: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine A3 receptor activity at a ratio of about 3: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine A3 receptor activity at a ratio of about 4: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine A3 receptor activity at a ratio of about 5: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine A3 receptor activity at a ratio of about 6: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine A3 receptor activity at a ratio of about 7: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine A3 receptor activity at a ratio of about 8: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine A3 receptor activity at a ratio of about 9: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine A3 receptor activity at a ratio of about 10: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine A3 receptor activity at a ratio of about 20: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine A3 receptor activity at a ratio of about 25: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine A3 receptor activity at a ratio of about 30: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine A3 receptor activity at a ratio of about 40: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine A3 receptor activity at a ratio of about 50: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine A3 receptor activity at a ratio of about 100: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine A3 receptor activity at a ratio of about 200: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine A3 receptor activity at a ratio of about 300: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine A3 receptor activity at a ratio of about 400: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine A3 receptor activity at a ratio of about 500: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine A3 receptor activity at a ratio of about 600: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine A3 receptor activity at a ratio of about 700: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine A3 receptor activity at a ratio of about 800: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine A3 receptor activity at a ratio of about 900: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine A3 receptor activity at a ratio of about 1000: about 1.

In embodiments, the method inhibits adenosine A2B receptor activity to adenosine a1 receptor activity at a ratio of about 1: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine a1 receptor activity at a ratio of about 2: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine a1 receptor activity at a ratio of about 3: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine a1 receptor activity at a ratio of about 4: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine a1 receptor activity at a ratio of about 5: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine a1 receptor activity at a ratio of about 6: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine a1 receptor activity at a ratio of about 7: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine a1 receptor activity at a ratio of about 8: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine a1 receptor activity at a ratio of about 9: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine a1 receptor activity at a ratio of about 10: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine a1 receptor activity at a ratio of about 20: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine a1 receptor activity at a ratio of about 25: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine a1 receptor activity at a ratio of about 30: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine a1 receptor activity at a ratio of about 40: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine a1 receptor activity at a ratio of about 50: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine a1 receptor activity at a ratio of about 100: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine a1 receptor activity at a ratio of about 200: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine a1 receptor activity at a ratio of about 300: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine a1 receptor activity at a ratio of about 400: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine a1 receptor activity at a ratio of about 500: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine a1 receptor activity at a ratio of about 600: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine a1 receptor activity at a ratio of about 700: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine a1 receptor activity at a ratio of about 800: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine a1 receptor activity at a ratio of about 900: about 1. In embodiments, the method inhibits adenosine A2B receptor activity to adenosine a1 receptor activity at a ratio of about 1000: about 1.

In embodiments, the methods inhibit adenosine A2B receptor activity and do not inhibit adenosine A3 receptor activity.

In one aspect, there is provided a method of inhibiting the activity of the adenosine A2B receptor, which method comprises contacting the adenosine A2B receptor with a compound as described herein (including the examples).

In one aspect, there is provided a method of inhibiting the activity of the adenosine A2A receptor, which method comprises contacting the adenosine A2A receptor with a compound as described herein (including the examples).

In one aspect, there is provided a method of treating cancer, the method comprising administering to a subject in need thereof an effective amount of a compound as described herein (including the examples). In embodiments, the cancer is breast, lung, colon, bladder, kidney, liver, pancreas, melanoma, leukemia, lymphoma, or prostate cancer. In an embodiment, the cancer is breast cancer. In an embodiment, the cancer is lung cancer. In an embodiment, the cancer is colon cancer. In an embodiment, the cancer is bladder cancer. In an embodiment, the cancer is renal cancer. In embodiments, the cancer is liver cancer. In an embodiment, the cancer is pancreatic cancer. In an embodiment, the cancer is melanoma. In an embodiment, the cancer is leukemia. In an embodiment, the cancer is lymphoma. In an embodiment, the cancer is prostate cancer.

In one aspect, there is provided a method of treating a fibrotic disease, the method comprising administering to a subject in need thereof an effective amount of a compound as described herein (including the examples). In embodiments, the fibrotic disease is pulmonary fibrosis. In embodiments, the fibrotic disease is Idiopathic Pulmonary Fibrosis (IPF). In embodiments, the fibrotic disease is Idiopathic Pulmonary Fibrosis (IPF), myocardial infarction, myocardial hypertrophy, heart failure, cirrhosis, acetaminophen (paracetamol) hepatotoxicity, hepatitis C liver disease, fatty liver (hepatosteatosis/fatty liver disease), or liver fibrosis. In the examples, the fibrotic disease is nonalcoholic steatohepatitis (NASH). In the examples, the fibrotic disease is non-alcoholic fatty liver disease (NAFLD).

In one aspect, there is provided a method of treating a neurodegenerative disease, the method comprising administering to a subject in need thereof an effective amount of a compound as described herein (including the examples). In embodiments, the neurodegenerative disease is alzheimer's disease, huntington's disease, multiple sclerosis, parkinson's disease, retinitis pigmentosa, amyotrophic lateral sclerosis, retinal degeneration, macular degeneration, prion disease, creutzfeldt-jakob disease, or kuru. In an embodiment, the neurodegenerative disease is alzheimer's disease. In an embodiment, the neurodegenerative disease is huntington's disease. In an embodiment, the neurodegenerative disease is multiple sclerosis. In an embodiment, the neurodegenerative disease is parkinson's disease. In an embodiment, the neurodegenerative disease is amyotrophic lateral sclerosis.

In embodiments, the method comprises administering a second agent (e.g., a therapeutic agent). In embodiments, the method comprises administering a therapeutically effective amount of a second agent (e.g., a therapeutic agent). In an embodiment, the second agent is an agent for treating cancer. In embodiments, the second agent is an anti-cancer agent. In an embodiment, the second agent is chemotherapy. In embodiments, the second agent is an anti-inflammatory agent. In an embodiment, the second agent is an agent for treating fibrosis. In an embodiment, the second agent is an agent for treating a neurodegenerative disease.

In one aspect, there is provided a method of inhibiting adenosine receptor activity, the method comprising contacting the adenosine receptor (e.g. a1, A2A, A2B or A3) with a compound as described herein (including the examples).

It is understood that the examples and embodiments described herein are for illustrative purposes only and that various modifications or changes in light thereof will be suggested to persons skilled in the art and are to be included within the spirit and purview of this application and scope of the appended claims. All publications, patents, and patent applications cited herein are hereby incorporated by reference in their entirety for all purposes.

589页详细技术资料下载

上一篇：一种医用注射器针头装配设备

下一篇：治疗癌症的方法及组合疗法

Compounds and methods for modulating adenosine A2B receptor and adenosine A2A receptor

相关技术

网友询问留言